KEGG   Postia placenta: POSPLDRAFT_87334Help
Entry
POSPLDRAFT_87334  CDS       T01162                                 

Definition
(GenBank) predicted protein
  KO
K08738  cytochrome c
Organism
ppl  Postia placenta
Pathway
ppl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    POSPLDRAFT_87334
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Cytochrom_C Cytochrome_CBB3 Cytochrom_C550
Motif
Other DBs
NCBI-ProteinID: EED83268
JGI: 87334
UniProt: B8P796
AA seq 108 aa AA seqDB search
MPFQAGDANKGAGLFKTRCAQCHTVGAGEPNKVGPNLHGLFGRKSGQVEGFSYTAANVNK
GVVWEEETLFEYLENPKKYIPGTKMAFAGLKKEKDRNDLITWLKDSTA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgcccttccaggctggtgacgctaacaagggtgctggtctattcaagacccgttgcgct
cagtgccacaccgttggcgcgggcgagcccaacaaggttggccccaacttgcatggtctc
ttcggtcgcaagtctggtcaggttgaaggcttctcatacactgctgccaatgtcaacaag
ggtgttgtctgggaggaggaaactcttttcgagtacctcgagaaccccaaaaagtacatc
cctggtacgaagatggcgttcgcaggtctcaagaaggagaaggaccgcaacgatctcatt
acctggctcaaggactcgaccgcataa

DBGET integrated database retrieval system