KEGG   Postia placenta: POSPLDRAFT_87511Help
Entry
POSPLDRAFT_87511  CDS       T01162                                 

Definition
cytochrome-c from the OXPHOS pathway
Orthology
K08738  
cytochrome c
Organism
ppl  Postia placenta
Pathway
Sulfur metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Metabolism
  Energy metabolism
   00920 Sulfur metabolism
    POSPLDRAFT_87511
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 108 aa AA seqDB search
MPFQAGDANKGAGLFKTRCAQCHTVGAGEPNKVGPNLHGLFGRKSGQVEGFSYTAANVNK
GVVWEEETLFEYLENPKKYIPGTKMAFAGLKKEKDRNDLITWLKDSTA
NT seq 327 nt NT seq  +upstreamnt  +downstreamnt
atgcctttccaggctggtgacgctaacaagggtgctggtctgttcaagacccgttgcgct
cagtgccacaccgtcggcgcgggcgagcccaacaaggttggccccaacttgcatggtctc
ttcggtcgcaagtctggtcaggttgaaggcttctcatacactgctgccaatgtcaacaag
ggtgttgtctgggaggaggagactcttttcgagtacctcgagaaccccaaaaagtacatc
cctggtacgaagatggcgttcgcgggtctcaagaaggagaaggaccgcaacgacctcatt
acctggctcaaggactcgaccgcataa

DBGET integrated database retrieval system