KEGG   Postia placenta: POSPLDRAFT_87716Help
Entry
POSPLDRAFT_87716  CDS       T01162                                 

Definition
hypothetical protein
Orthology
K00327  
NADPH-ferrihemoprotein reductase [EC:1.6.2.4]
Organism
ppl  Postia placenta
Brite
Enzymes [BR:ppl01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     POSPLDRAFT_87716
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 655 aa AA seqDB search
MASSSDVLILAVGLVLAAVYLFRDQLFSASKPKSAPVAAPKGGAGSGNPRDFVAKMKEGN
LSDESFEFSNGEHKLPDLKYVVFGLGNRTYEHYNLISRNVDRDLSKMGAIRIGERGEGDD
DKSMEEDYLEWKDAMWEAFALAMGVEEGQGGDTPDFTVTEVEDHPPEKVYLGELSARALT
RSKGIHDAKNPYPAPITVARELFQESADRNCIHVEFNTEGSGITYQHGDHVGVWPSNAEN
EVQRLLCALGLVEKKDTVINIESLDPALAKVPFPVPTTYITVLRHYIDVSAVVGRQILGV
MSKFAPTPEAEAFLKNLNTNKEEYATVVTNGSLKLGEVLQLAVGNDLSVEPTPENTTAWS
IPFDIIVSSIPRLQPRYYSISSSPKLYANSIHATVVVLAYESIESEKVKQRWVHGVGSNF
LLNLKFAASGENAAVLSDKSHIQHPAAALTPKYAIEGPRGAYKQDSIYKAPVHVRRSTFR
LPTNPKSPVIMIGPGTGVAPFRGFVQERVAMARRTIEKNGVEGLADWGNIRLYFGCRRSD
QDFLYKEEWPEYAAELHGKFTMRCAFSREPPYKPDGSKIYVQDLLWEDHEEIADAILNGK
GYVYICGDAKSMSKAVEETLCRILGEAKGGTAEVEGAAEVKLLKERSRMLSDVWS
NT seq 1968 nt NT seq  +upstreamnt  +downstreamnt
atggcgtcgtcttccgatgtcctcatcctcgcggtcggactggttctcgctgcagtctat
ctgtttcgggaccagctgttctctgcctccaaacccaagtctgccccggtcgctgccccc
aaggggggtgctggatctggaaaccctcgggactttgtggctaagatgaaggaaggcaat
ctttccgacgagtcctttgagttttcgaacggcgagcacaagctacctgacctcaaatac
gtcgtcttcggcctcggtaacaggacatacgagcactataatctcatctcgaggaatgtt
gaccgggacctgtcgaagatgggtgccatccgcatcggtgagcgcggagagggcgatgac
gataagagtatggaggaggactacctagagtggaaggacgctatgtgggaggcgttcgca
ctggccatgggcgtcgaagagggacagggtggtgacactcccgacttcactgtcaccgag
gtcgaagaccacccaccagagaaggtgtatctcggtgaattgtctgcccgcgcactgaca
cgttcgaagggtatccacgatgcaaagaacccgtacccggctcccattacagttgcacgc
gagctcttccaagagagcgcggatcgcaactgcattcacgtcgaattcaacacggaaggt
tctggtattacatatcagcacggcgatcacgtcggtgtctggccgtccaacgcagagaac
gaggtgcaacggctattatgcgctcttggcttggttgagaagaaggacacggtgatcaac
attgagtccctagaccctgccttggcaaaggtaccgttccctgtccccactacctacatc
acggtccttcgccactacatcgacgtcagcgctgttgttggtcgtcagattctcggagtc
atgagcaagttcgcacccacgcccgaggcggaggccttcctcaaaaacctcaacactaac
aaagaggagtatgcgaccgtcgtcaccaatggctccctcaagcttggcgaggtgctgcaa
ctggctgtcggcaacgatctctctgtagagcccacgccggagaacacgactgcgtggtcg
attccctttgatatcatcgtctcgtctatcccacgtctccagccgcgctattattcgatc
tcttccagcccgaagctctacgcgaactcaatccacgccactgtcgtcgtcctcgcctac
gagtcgatcgagagcgagaaggtcaagcagcgctgggtgcacggtgttggctctaacttc
ctactcaacctcaaatttgctgctagcggtgagaatgccgctgtgctttccgacaagagt
catatccaacaccccgcggccgcgctgacaccaaagtacgcgattgaggggccgcgtggt
gcttacaagcaggattccatctacaaggcgcctgtccatgtccgacgatcgacattccga
ctgccaacaaaccccaagagcccagtgattatgattggtcccggaactggtgtcgcacct
ttccgtggattcgtgcaggaacgtgtcgcaatggcgcgccgcacgatcgagaagaacggt
gtggagggtctcgcggactggggtaacatccgcctgtacttcggctgccggcgctccgat
caagacttcttgtacaaagaagagtggcccgagtacgcggcggagctccatggaaagttc
acgatgcgctgcgccttctcgcgggagccaccatacaagcccgacggcagcaagatctac
gtgcaggacctactgtgggaggaccacgaggagatcgcagatgcgattctcaatggcaag
gggtacgtttacatttgcggtgacgccaagagcatgagcaaggcggtcgaggagacgctg
tgccggatattgggcgaggcgaagggcggtaccgcggaggtcgagggcgcggcggaggtg
aaactcctgaaggagcgcagccgtatgctgtcggatgtgtggagttga

DBGET integrated database retrieval system