KEGG   Postia placenta: POSPLDRAFT_88581Help
Entry
POSPLDRAFT_88581  CDS       T01162                                 

Definition
hypothetical protein
Orthology
K07511  
enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppl  Postia placenta
Pathway
Fatty acid elongation
Fatty acid degradation
Valine, leucine and isoleucine degradation
Lysine degradation
Tryptophan metabolism
beta-Alanine metabolism
Propanoate metabolism
Butanoate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Carbon metabolism
Fatty acid metabolism
Class
Metabolism; Overview; Carbon metabolism [PATH:ppl01200]
Metabolism; Overview; Fatty acid metabolism [PATH:ppl01212]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ppl00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ppl00650]
Metabolism; Lipid metabolism; Fatty acid elongation [PATH:ppl00062]
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ppl00071]
Metabolism; Amino acid metabolism; Valine, leucine and isoleucine degradation [PATH:ppl00280]
Metabolism; Amino acid metabolism; Lysine degradation [PATH:ppl00310]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ppl00380]
Metabolism; Metabolism of other amino acids; beta-Alanine metabolism [PATH:ppl00410]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 256 aa AA seqDB search
MSKTNIIVSRPTPAVALVTLNRPKVLNALSAALIDELVSALSLLDTDDTTRAIVITGNER
AFAAGADIKEMKDKTYVDVFKHKFLENWTLISHVRKPVIAAVSGYALGGGCEIAMACDIV
LASPTAVFGLPEIDIGVIPGAGGTQRLVRAIGKSRAMELILSGRRFSATDAAAWGVVSRV
SEDVFADAIELATTIAGKGTIAVQAAKEAINVAFETSLDEGLRHERTIFYGLFATQDQKE
GMSAFAEKRPPVWSHS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagacaaacatcatcgtctcacgcccgactcccgctgtcgcactcgtcactttg
aacaggcccaaagtcttgaacgcactttccgctgcgctcatcgacgaacttgtgagcgcg
ttgtcgcttttggacacggatgataccactcgggcgattgttatcactggcaatgagcga
gcatttgcagcgggtgcagatataaaggagatgaaagacaaaacttatgtggatgtattc
aagcacaagttcttagagaactggactctcatatcacatgtacggaagcccgtcattgct
gcagtgagcgggtatgctcttggtggtggctgtgagattgccatggcgtgcgacattgtc
cttgcttctcctactgctgttttcggtcttcccgagatcgatataggcgtcataccagga
gcaggtggaactcagcgactcgttcgtgcgattggtaaatcgcgcgccatggagctgatt
cttagcggacgccggttcagcgccaccgatgccgccgcgtggggtgttgtctcgcgcgtc
tctgaggacgtctttgcggacgcgattgagcttgcaaccactattgccgggaagggtact
attgccgtgcaagcagcaaaggaggcgatcaacgtcgcgtttgagacgtccctcgatgag
ggattgcggcacgagcggacaatcttctatggcctatttgcgacgcaggatcagaaagag
ggaatgtcggcgtttgctgagaaaaggccgccggtatggtcgcactcgtga

DBGET integrated database retrieval system