KEGG   Postia placenta: POSPLDRAFT_88581Help
Entry
POSPLDRAFT_88581  CDS       T01162                                 

Definition
(GenBank) predicted protein
  KO
K07511  enoyl-CoA hydratase [EC:4.2.1.17]
Organism
ppl  Postia placenta
Pathway
ppl00062  Fatty acid elongation
ppl00071  Fatty acid degradation
ppl00280  Valine, leucine and isoleucine degradation
ppl00310  Lysine degradation
ppl00380  Tryptophan metabolism
ppl00410  beta-Alanine metabolism
ppl00640  Propanoate metabolism
ppl00650  Butanoate metabolism
ppl01100  Metabolic pathways
ppl01110  Biosynthesis of secondary metabolites
ppl01130  Biosynthesis of antibiotics
ppl01200  Carbon metabolism
ppl01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    POSPLDRAFT_88581
   00650 Butanoate metabolism
    POSPLDRAFT_88581
  Lipid metabolism
   00062 Fatty acid elongation
    POSPLDRAFT_88581
   00071 Fatty acid degradation
    POSPLDRAFT_88581
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    POSPLDRAFT_88581
   00310 Lysine degradation
    POSPLDRAFT_88581
   00380 Tryptophan metabolism
    POSPLDRAFT_88581
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    POSPLDRAFT_88581
Enzymes [BR:ppl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     POSPLDRAFT_88581
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ECH_1 ECH_2 Peptidase_S49 SDH_sah
Motif
Other DBs
NCBI-ProteinID: EED79819
JGI: 88581
UniProt: B8PH17
AA seq 256 aa AA seqDB search
MSKTNIIVSRPTPAVALVTLNRPKVLNALSAALIDELVSALSLLDTDDTTRAIVITGNER
AFAAGADIKEMKDKTYVDVFKHKFLENWTLISHVRKPVIAAVSGYALGGGCEIAMACDIV
LASPTAVFGLPEIDIGVIPGAGGTQRLVRAIGKSRAMELILSGRRFSATDAAAWGVVSRV
SEDVFADAIELATTIAGKGTIAVQAAKEAINVAFETSLDEGLRHERTIFYGLFATQDQKE
GMSAFAEKRPPVWSHS
NT seq 771 nt NT seq  +upstreamnt  +downstreamnt
atgtcgaagacaaacatcatcgtctcacgcccgactcccgctgtcgcactcgtcactttg
aacaggcccaaagtcttgaacgcactttccgctgcgctcatcgacgaacttgtgagcgcg
ttgtcgcttttggacacggatgataccactcgggcgattgttatcactggcaatgagcga
gcatttgcagcgggtgcagatataaaggagatgaaagacaaaacttatgtggatgtattc
aagcacaagttcttagagaactggactctcatatcacatgtacggaagcccgtcattgct
gcagtgagcgggtatgctcttggtggtggctgtgagattgccatggcgtgcgacattgtc
cttgcttctcctactgctgttttcggtcttcccgagatcgatataggcgtcataccagga
gcaggtggaactcagcgactcgttcgtgcgattggtaaatcgcgcgccatggagctgatt
cttagcggacgccggttcagcgccaccgatgccgccgcgtggggtgttgtctcgcgcgtc
tctgaggacgtctttgcggacgcgattgagcttgcaaccactattgccgggaagggtact
attgccgtgcaagcagcaaaggaggcgatcaacgtcgcgtttgagacgtccctcgatgag
ggattgcggcacgagcggacaatcttctatggcctatttgcgacgcaggatcagaaagag
ggaatgtcggcgtttgctgagaaaaggccgccggtatggtcgcactcgtga

DBGET integrated database retrieval system