KEGG   Postia placenta: POSPLDRAFT_89715Help
Entry
POSPLDRAFT_89715  CDS       T01162                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
ppl  Postia placenta
Pathway
Endocytosis
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Cellular Processes
  Transport and catabolism
   04144 Endocytosis
    POSPLDRAFT_89715
Enzymes [BR:ppl01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.2  Thioester hydrolases
    3.1.2.15  ubiquitin thiolesterase
     POSPLDRAFT_89715
Peptidases [BR:ppl01002]
 Cysteine Peptidases
  Family C19: ubiquitin-specific protease family
   POSPLDRAFT_89715
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1026 aa AA seqDB search
MQNGASTSHGGTVAEIKDTAKEQVLKVRGASAISLLKSARAQCRIAEECELEGNTKGALS
ALTKAASLVQMFMDSAEFKQETQPGRRADEEESPALRSTGVVSIADRMRSLQNAGLAVSS
TKRLSRENLPPPPSSSFPMLASPVVASSSTVASPHALVPTSSFGPPSPSSSASSSPHLSH
LSLSEFGKAFPSIDELDEADGLKLPSLPTGSSIGRQDGFPPQLFAHPKPFPALPMDPGPR
PSSTPIPPTINTFASRPASPARSPLSPTKPPEIPVSTTLFPKALLDYNRRHNFKVLVLDV
RTRGDFEKEHIKADAIVCIEPSVLLRNDVTAQTIEDSLVVAPRNESMLFANRDKFDLIAV
YDESSETFGDANSPLAIFVRAVYERAFRKILKHPPMLLVGGLQAWKREFGETELVRGGSS
TGSDVGDVAPPPAFASTPSYEQSTGGRHRAGTESSVDAHRPWIPPQPTPPFSPEQSPASF
RSGPDSPLSPPLDQAKRLVRKHAITRPTSNSISNSSPPIPENATAQYVSPALVNGTTIQY
PSVTRHISPQISGSSFSSSPALNGIVSMPPQASINPSPLSRRRSDYVDQSQEALSGLVAR
PSIDYPDLSSQHVLRPPPAAASSGMERQDNRPRLLQSQSYSMQPTGPKPPTIQSDYPVTY
WADIQIGTSGLKNLGNTCYMNSTIQCLSATVPFSRFFTDGRWKSAVNMMNPMGTKGNLAN
AFANILRDMWQGEMQCLSPVTFRRSLCMYAPQFGGTEQHDSQEFLNFLLDGLHEDLNRVL
QKPQIETTPEREAELERLPTQIAREQEWQIWRMRNDSLVVDFFQGQFRNRLECLTCHKTS
TTYNTFMYLTLPIPIGRGSKVSLYQCLDAFVKEEVMEKSDAWNCPHCKALRKATKNLSLS
RLPPVLLIHLKRFSSKGHFTDKIETFVDYPIRSLDLTNYMPPPLPPGVDMGLQPSRDDPR
AQVPPYRYDLYGVTNHFGTLSSGHYTAFISSRGGWLYCDDSRISQADTKDVVGKPAYMLF
YKRTKA
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatggagccagcacttcgcatggcggaacagtggcagagatcaaggatacagca
aaggaacaggtcctcaaggtccgcggggcatcggccatttccttgctgaagagcgcacgg
gcacagtgccgcattgctgaggaatgcgaactggaggggaacaccaagggcgcgctcagc
gcgctcaccaaggctgcgtctctcgtacagatgttcatggactctgcagagttcaagcag
gagacgcagccgggacgcagggcagatgaggaagagtcccctgcacttagatcgacaggc
gtcgtcagcattgcagacagaatgcgctcactacagaacgcgggtctcgctgtttcgtcg
acaaaacgtctttctcgagagaatctacctcccccgccatcctcgagtttcccaatgtta
gcgtcgccagtagtcgccagttcgtccacagtcgcgtcgccccacgcactggtgccaacg
tcgagcttcggccccccgtctccatcgtcctcggcatcgtcttcgccccacctgtctcac
ctcagcttgtcagagttcggtaaggcctttccatcaatagacgagctggatgaggcggac
gggttgaagctgccgtccctgcccaccggttcgagcataggcagacaggatggattcccg
ccgcagctgtttgcacatccgaagccgttccctgctcttcccatggaccccggtccccgg
ccatccagcacgcctattccaccgacgatcaacactttcgcgagccggcctgcctctccc
gcccgctcgccgttgtcacccactaagccgccggagatcccggtgtccacaacattgttc
ccgaaggcgctgctggactacaaccggcggcataatttcaaggtactggtattggacgtg
cggacgcgtggggattttgagaaggagcatattaaggcagatgctatcgtatgcatcgag
ccaagcgtcttgctgcgcaacgacgtcaccgcgcagaccatcgaagactcgcttgtagtc
gcgcctcggaatgagtctatgctcttcgcaaatcgcgacaagttcgatcttattgcggtg
tacgatgagtcgtccgagacctttggcgatgcgaattcgcctttggctatcttcgtccga
gccgtctacgagcgtgcattccgcaaaatcctgaagcacccaccaatgctattggtaggc
ggcctgcaggcgtggaaacgggaattcggagagaccgagctggtccgcggcggatcgagt
actggctctgacgttggggacgtagctccgccgcctgcttttgcttcgacccccagttat
gagcagtcgacaggcggtcgccatcgagcaggcacagagtcctctgtcgacgctcataga
ccctggataccgccccagcccactccgccgttctcgcccgaacagtcgccagcgtccttc
cgttctggcccagattcccctctgtccccgccgctagatcaggcgaagcgcttggtacgc
aaacatgcgattacccggccaacgtcaaactcgatatccaactcctcgcccccaataccg
gaaaacgcaaccgcgcaatatgtatctccagctctggtcaacggaacgactatccaatac
cccagcgttacccgccatatatccccccaaatctctggatcgtccttttcttcttcccct
gcactcaatggcattgtgtctatgcctcctcaagcgtctatcaacccgtctccgctctcg
cgacgccggagtgattacgttgaccagtcacaagaagccctatctggtctagttgcacgc
ccgtctatagactatcctgatctctcgtcgcagcacgtactaaggccaccacctgccgcc
gcctcttccggaatggagagacaggataaccggcctcgcctcctgcaaagccagtcgtac
tcgatgcagccgacaggtcctaagcccccgactatacagtccgactatcctgtcacatat
tgggccgacatccagattggtacctcaggtctcaagaatctcggcaacacctgctacatg
aactcaacgatacagtgcttgagtgcgacggtacctttttcgaggttcttcacagatggg
cgatggaagagcgcggttaacatgatgaatccgatgggtacaaagggaaatctagcaaat
gcttttgcgaatattttgcgggatatgtggcaaggcgaaatgcaatgtctgtcccctgta
acattcaggcggtctctatgcatgtacgcgccccagtttggaggcactgagcagcacgat
tcacaagagttcctcaatttccttctggatggtctacacgaggacctcaacagggtcctt
cagaagccacagatagagactacgccggaacgcgaagccgagctcgaaaggcttcccact
cagatcgccagggagcaggaatggcagatctggcgcatgcgcaacgatagtctggttgtc
gacttctttcagggtcagtttcgcaatcgtctcgaatgtcttacgtgtcataagacgtca
acaacgtacaacacattcatgtatctgactttacccattcccattggccgcggatcaaag
gtctccctgtatcagtgtttggatgctttcgtcaaagaggaagtaatggagaagtcagat
gcttggaactgcccgcattgcaaggctcttcggaaggcaaccaagaacttgtctctgtct
cgtctcccgccggtcctcctcatacacctgaagcgattttcgtcgaagggccactttacg
gacaagattgagacatttgtcgactacccaatacggagcctcgatctgaccaactatatg
cctccgccattgccacctggcgtcgatatgggactgcagccgtcgcgagacgatccgcga
gcacaggtaccgccgtacagatacgacctgtatggggtaacgaaccacttcggcacgttg
agcagtgggcattataccgcgttcatatcttcccggggaggttggctatactgtgacgat
agtcgtatatcccaagccgacaccaaggacgtcgttggcaaaccagcctatatgctgttt
tacaagaggaccaaagcctga

DBGET integrated database retrieval system