KEGG   Postia placenta: POSPLDRAFT_89715Help
Entry
POSPLDRAFT_89715  CDS       T01162                                 

Definition
hypothetical protein
Orthology
K11839  
ubiquitin carboxyl-terminal hydrolase 8 [EC:3.1.2.15]
Organism
ppl  Postia placenta
Pathway
Endocytosis
Class
Cellular Processes; Transport and catabolism; Endocytosis [PATH:ppl04144]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1026 aa AA seqDB search
MQNGASTSHGGTVAEIKDTAKEQVLKVRGASAISLLKSARAQCRIAEECELEGNTKGALS
ALTKAASLVQMFMDSAEFKQETQPGRRADEEESPALRSTGVVSIADRMRSLQNAGLAVSS
TKRLSRENLPPPPSSSFPMLASPVVASSSTVASPHALVPTSSFGPPSPSSSASSSPHLSH
LSLSEFGKAFPSIDELDEADGLKLPSLPTGSSIGRQDGFPPQLFAHPKPFPALPMDPGPR
PSSTPIPPTINTFASRPASPARSPLSPTKPPEIPVSTTLFPKALLDYNRRHNFKVLVLDV
RTRGDFEKEHIKADAIVCIEPSVLLRNDVTAQTIEDSLVVAPRNESMLFANRDKFDLIAV
YDESSETFGDANSPLAIFVRAVYERAFRKILKHPPMLLVGGLQAWKREFGETELVRGGSS
TGSDVGDVAPPPAFASTPSYEQSTGGRHRAGTESSVDAHRPWIPPQPTPPFSPEQSPASF
RSGPDSPLSPPLDQAKRLVRKHAITRPTSNSISNSSPPIPENATAQYVSPALVNGTTIQY
PSVTRHISPQISGSSFSSSPALNGIVSMPPQASINPSPLSRRRSDYVDQSQEALSGLVAR
PSIDYPDLSSQHVLRPPPAAASSGMERQDNRPRLLQSQSYSMQPTGPKPPTIQSDYPVTY
WADIQIGTSGLKNLGNTCYMNSTIQCLSATVPFSRFFTDGRWKSAVNMMNPMGTKGNLAN
AFANILRDMWQGEMQCLSPVTFRRSLCMYAPQFGGTEQHDSQEFLNFLLDGLHEDLNRVL
QKPQIETTPEREAELERLPTQIAREQEWQIWRMRNDSLVVDFFQGQFRNRLECLTCHKTS
TTYNTFMYLTLPIPIGRGSKVSLYQCLDAFVKEEVMEKSDAWNCPHCKALRKATKNLSLS
RLPPVLLIHLKRFSSKGHFTDKIETFVDYPIRSLDLTNYMPPPLPPGVDMGLQPSRDDPR
AQVPPYRYDLYGVTNHFGTLSSGHYTAFISSRGGWLYCDDSRISQADTKDVVGKPAYMLF
YKRTKA
NT seq 3081 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaatggagccagcacttcgcatggcggaacagtggcagagatcaaggatacagca
aaggaacaggtcctcaaggtccgcggggcatcggccatttccttgctgaagagcgcacgg
gcacagtgccgcattgctgaggaatgcgaactggaggggaacaccaagggcgcgctcagc
gcgctcaccaaggctgcgtctctcgtacagatgttcatggactctgcagagttcaagcag
gagacgcagccgggacgcagggcagatgaggaagagtcccctgcacttagatcgacaggc
gtcgtcagcattgcagacagaatgcgctcactacagaacgcgggtctcgctgtttcgtcg
acaaaacgtctttctcgagagaatctacctcccccgccatcctcgagtttcccaatgtta
gcgtcgccagtagtcgccagttcgtccacagtcgcgtcgccccacgcactggtgccaacg
tcgagcttcggccccccgtctccatcgtcctcggcatcgtcttcgccccacctgtctcac
ctcagcttgtcagagttcggtaaggcctttccatcaatagacgagctggatgaggcggac
gggttgaagctgccgtccctgcccaccggttcgagcataggcagacaggatggattcccg
ccgcagctgtttgcacatccgaagccgttccctgctcttcccatggaccccggtccccgg
ccatccagcacgcctattccaccgacgatcaacactttcgcgagccggcctgcctctccc
gcccgctcgccgttgtcacccactaagccgccggagatcccggtgtccacaacattgttc
ccgaaggcgctgctggactacaaccggcggcataatttcaaggtactggtattggacgtg
cggacgcgtggggattttgagaaggagcatattaaggcagatgctatcgtatgcatcgag
ccaagcgtcttgctgcgcaacgacgtcaccgcgcagaccatcgaagactcgcttgtagtc
gcgcctcggaatgagtctatgctcttcgcaaatcgcgacaagttcgatcttattgcggtg
tacgatgagtcgtccgagacctttggcgatgcgaattcgcctttggctatcttcgtccga
gccgtctacgagcgtgcattccgcaaaatcctgaagcacccaccaatgctattggtaggc
ggcctgcaggcgtggaaacgggaattcggagagaccgagctggtccgcggcggatcgagt
actggctctgacgttggggacgtagctccgccgcctgcttttgcttcgacccccagttat
gagcagtcgacaggcggtcgccatcgagcaggcacagagtcctctgtcgacgctcataga
ccctggataccgccccagcccactccgccgttctcgcccgaacagtcgccagcgtccttc
cgttctggcccagattcccctctgtccccgccgctagatcaggcgaagcgcttggtacgc
aaacatgcgattacccggccaacgtcaaactcgatatccaactcctcgcccccaataccg
gaaaacgcaaccgcgcaatatgtatctccagctctggtcaacggaacgactatccaatac
cccagcgttacccgccatatatccccccaaatctctggatcgtccttttcttcttcccct
gcactcaatggcattgtgtctatgcctcctcaagcgtctatcaacccgtctccgctctcg
cgacgccggagtgattacgttgaccagtcacaagaagccctatctggtctagttgcacgc
ccgtctatagactatcctgatctctcgtcgcagcacgtactaaggccaccacctgccgcc
gcctcttccggaatggagagacaggataaccggcctcgcctcctgcaaagccagtcgtac
tcgatgcagccgacaggtcctaagcccccgactatacagtccgactatcctgtcacatat
tgggccgacatccagattggtacctcaggtctcaagaatctcggcaacacctgctacatg
aactcaacgatacagtgcttgagtgcgacggtacctttttcgaggttcttcacagatggg
cgatggaagagcgcggttaacatgatgaatccgatgggtacaaagggaaatctagcaaat
gcttttgcgaatattttgcgggatatgtggcaaggcgaaatgcaatgtctgtcccctgta
acattcaggcggtctctatgcatgtacgcgccccagtttggaggcactgagcagcacgat
tcacaagagttcctcaatttccttctggatggtctacacgaggacctcaacagggtcctt
cagaagccacagatagagactacgccggaacgcgaagccgagctcgaaaggcttcccact
cagatcgccagggagcaggaatggcagatctggcgcatgcgcaacgatagtctggttgtc
gacttctttcagggtcagtttcgcaatcgtctcgaatgtcttacgtgtcataagacgtca
acaacgtacaacacattcatgtatctgactttacccattcccattggccgcggatcaaag
gtctccctgtatcagtgtttggatgctttcgtcaaagaggaagtaatggagaagtcagat
gcttggaactgcccgcattgcaaggctcttcggaaggcaaccaagaacttgtctctgtct
cgtctcccgccggtcctcctcatacacctgaagcgattttcgtcgaagggccactttacg
gacaagattgagacatttgtcgactacccaatacggagcctcgatctgaccaactatatg
cctccgccattgccacctggcgtcgatatgggactgcagccgtcgcgagacgatccgcga
gcacaggtaccgccgtacagatacgacctgtatggggtaacgaaccacttcggcacgttg
agcagtgggcattataccgcgttcatatcttcccggggaggttggctatactgtgacgat
agtcgtatatcccaagccgacaccaaggacgtcgttggcaaaccagcctatatgctgttt
tacaagaggaccaaagcctga

DBGET integrated database retrieval system