KEGG   Postia placenta: POSPLDRAFT_90855Help
Entry
POSPLDRAFT_90855  CDS       T01162                                 

Definition
hypothetical protein
Orthology
K07739  
elongator complex protein 3 [EC:2.3.1.48]
Organism
ppl  Postia placenta
Class
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 556 aa AA seqDB search
MVQRTKTEGPSQAEQLLRVTAGIAAELIKAHDANQTVSLNELRAKMSKKYGFGGVPRLVD
IISAIPDDYKKALLPKLKARPIRTASGIAVVAVMCKPHRCPHIAMTGNICVYCPGGPDSD
FDYSTQSYTGYEPTSMRAIRARYDPYEQTRGRVEQLKSLGHNVDKVEFIVMGGTFMSMPE
DYRNKFIAQLHNALSGFTGFDVDEAVRYSEQSKSKAIGITIETRPDYCLRPHLSQMLRYG
CTRLEIGVQSVYEDVARDTNRGHTVRAVSESFHLAKDAGFKVVAHMMPDLPNVGVERDLE
QFKEYFENPAFRSDGLKIYPTLVIRGTGLYELWRTGRYKNYTPNVLVDVVARILALVPPW
TRVYRVQRDIPLPLVTSGCENSGNLRELALNRMKDFGAECRDVRFREVGIHEIHHKVRPE
SVELLRRDYAANGGWETFLSYEDPERDILIGLLRLRKCSDEGTFRPELVKKEGEEGGCSI
VRELHVYGTAVPVHGRDPTKFQHQGFGTLLMEEAERIAREEHGSVKLAVISGVGTRDYYR
RLGYELDGPYMSKSLL
NT seq 1671 nt NT seq  +upstreamnt  +downstreamnt
atggtgcaaagaacgaagacagagggcccctcacaggccgagcagctgttacgagtcacc
gctggtattgcggcggagcttatcaaagcgcacgatgcgaaccagacagtttcgctcaac
gagcttcgggcaaagatgagcaagaagtatgggtttggtggcgtgccccggctggtggat
attatcagtgctatacccgatgactataagaaagctttgctgcccaaactcaaggcacgt
ccaatccgtacggcgagtgggatcgctgtcgtcgcggtgatgtgtaaaccacatcgatgt
ccacacatcgctatgactggaaacatatgcgtctattgtccaggaggaccagattcagac
tttgactatagcacacaaagttataccggctatgagcctactagcatgcgtgccatccgt
gctcgttatgacccgtacgagcaaactcggggacgggtagaacagctcaagagtctggga
cataacgtggacaaggtcgaattcattgtcatgggcggcacgttcatgagcatgcccgag
gactaccggaataaattcattgcacaattgcacaacgccctatcgggcttcaccggattc
gatgttgacgaggccgtcagatattccgaacagagcaaatcaaaagcaatcggtatcacg
attgagacccgacccgactactgtctaagacctcatctgagtcagatgctgcgttacggc
tgtacccgtttggaaattggcgttcaatccgtgtacgaagacgttgctcgtgatactaat
cgcgggcacaccgtccgcgcagtgtcggagtccttccaccttgcgaaagatgcagggttc
aaggttgttgcgcacatgatgccagacctcccaaatgtgggcgtagagcgcgatctggag
caattcaaagaatactttgaaaatccagccttcaggagtgatgggctgaagatttatccg
acacttgtcatcagaggcaccggactctatgaattgtggaggacggggcgctacaaaaac
tacacgccgaatgtgctcgtagatgtcgtggcacggatcctggcgctcgtccctccgtgg
acacgggtgtaccgcgtgcaaagggacattcccctgcccctggttacgagcggctgcgaa
aattccgggaacctccgtgagttggccctgaaccgcatgaaggacttcggcgcagagtgt
cgtgatgtacgatttcgcgaagtcgggatccatgagattcaccacaaggtccgccctgag
tccgttgaactgctccgccgagactacgcggccaacgggggctgggagaccttcctgtcg
tacgaagaccccgaacgtgatatcttgattggattgctccgtctgcgaaaatgctcggac
gagggcaccttccggcctgaattagtgaagaaggaaggtgaagagggtggctgtagcatc
gtgcgcgagctgcacgtctacggaaccgcagtaccggttcacgggcgtgatccgacgaaa
tttcagcaccagggcttcggcacacttctcatggaggaagcggaacgaatagcgcgcgaa
gagcatggcagtgtcaagctggccgtcatttctggcgttggcactcgagattattatcga
cggctcggttacgagctggacggaccatacatgagcaaatccctactatga

DBGET integrated database retrieval system