KEGG   Postia placenta: POSPLDRAFT_92962Help
Entry
POSPLDRAFT_92962  CDS       T01162                                 

Definition
(GenBank) predicted protein
  KO
K01476  arginase [EC:3.5.3.1]
Organism
ppl  Postia placenta
Pathway
ppl00220  Arginine biosynthesis
ppl00330  Arginine and proline metabolism
ppl01100  Metabolic pathways
ppl01110  Biosynthesis of secondary metabolites
ppl01130  Biosynthesis of antibiotics
ppl01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Metabolism
  Amino acid metabolism
   00220 Arginine biosynthesis
    POSPLDRAFT_92962
   00330 Arginine and proline metabolism
    POSPLDRAFT_92962
Enzymes [BR:ppl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.1  arginase
     POSPLDRAFT_92962
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: EED80821
JGI: 92962
UniProt: B8PEB4
AA seq 114 aa AA seqDB search
MSSQPSISRFLPEPKTVAAKLGVDHGPIRLVQAGLPEQLAELGWKVQFDGHHQFEEIDTQ
NDPPIGKLKNPRLVSRVSQAVAQVVGGHAKKGVLPLTLGGDHSLAMXTISGTLE
NT seq 345 nt NT seq  +upstreamnt  +downstreamnt
atgtcgtctcagccctctatctcccgtttcctcccggagcccaagaccgtcgcggctaag
cttggcgtcgatcatggtcccatccgcctagtgcaggcagggctaccggagcagctcgca
gagctcggctggaaggtgcaattcgacggtcaccaccaattcgaggagatcgacactcag
aatgacccgcccattggcaaactgaagaacccgcgtctcgtttcgcgcgtttcccaggcc
gtcgcgcaggtcgtcggtgggcacgcgaagaagggtgttctgcccctcacgctcggcggc
gaccactccctggccatgngaacgatctctgggacactagagtaa

DBGET integrated database retrieval system