KEGG   Postia placenta: POSPLDRAFT_93071Help
Entry
POSPLDRAFT_93071  CDS       T01162                                 

Definition
hypothetical protein
Orthology
K01785  
aldose 1-epimerase [EC:5.1.3.3]
Organism
ppl  Postia placenta
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppl00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppl00052]
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 259 aa AA seqDB search
MVSPDDPSLTPLLLTLPSLTPSLALEVLPLGLTLHRLFVQADAKACTLPSPHPRALTRPQ
THDILIGPELPAGHLSQKYTNTIIGRYANRVPAGTHPVSRAGVHSSLTAASNESPSVSLH
GGLSGWDLAPWDPLPDLSAATLFSPDEQQTIGATLPSACVFVRESLNGEEGYPGRLRVEV
LVGLAQSNAPPPAASAEWLLGSVVLIYRARLLDTDKVTPINLTQHWGFNLDASLQDGQSV
KDHTLTIRDEQSVMRRALS
NT seq 779 nt NT seq  +upstreamnt  +downstreamnt
atggtgtccccagacgacccctccctcacgcccctgctcctcaccctcccctccctcacc
ccctctctcgccctcgaggtgctccccctcggcctcaccctccaccgcctctttgtccaa
gcagatgccaaggcatgtacgctcccctctccccacccacgcgcgctcacccgtccacag
acgcacgacatcctcatcggccccgagctccccgctggccacctctcccagaagtacaca
aacaccatcatcggccgctacgccaatcgcgtccccgcaggcacccaccccgtctcccgc
gctggcgtccactcctctctgaccgctgcctccaacgagtccccctccgtctccctccac
ggcggcctctccggctgggacctcgccccctgggatcccctccctgacctctccgccgcc
accctcttctctcccgacgagcagcaaaccatcggcgcaaccctcccgtccgcctgcgtc
tttgtccgcgagtctctcaacggcgaggagggctaccctggccgcctgcgcgtcgaggtc
cttgtcggccttgcccaatccaatgcaccgccccccgccgcctcggcagagtggcttctc
ggcagcgtcgttctcatctatcgtgcccgtcttctagacactgacaaggtcacccccata
aacctcacccaacactggggcttcaacctcgacgcttcgctccaggatggccagtccgtc
aaagaccacaccctcaccatccgcgacgagcagagcgtcatgcggcgtgcactctcctt

DBGET integrated database retrieval system