KEGG   Postia placenta: POSPLDRAFT_95335Help
Entry
POSPLDRAFT_95335  CDS       T01162                                 

Definition
hypothetical protein
Orthology
K00864  
glycerol kinase [EC:2.7.1.30]
Organism
ppl  Postia placenta
Pathway
Glycerolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Metabolism
  Lipid metabolism
   00561 Glycerolipid metabolism
    POSPLDRAFT_95335
Enzymes [BR:ppl01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.30  glycerol kinase
     POSPLDRAFT_95335
Exosome [BR:ppl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   POSPLDRAFT_95335
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 208 aa AA seqDB search
MPALKQGEFVGSLDCGTTSSRFLIFDKYADIVAEYQTEYPQYYPEPGWHEQDADEIMASC
DVCITEACKALEAAGWSKDSVKVIGITNQRETAVAWSRKTGKPLCRAIVWDDGRTKNTVA
HFERKLDYVGLEVQPGVFRKAKNGEAALKELVRTGLQLSTYFSAIKLRWMIEHHQQVKKA
HEEDDLLFGTVESWIVYVRDHSPPNDAR
NT seq 627 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcgctcaagcaaggggaattcgtcggctctctcgactgtggtaccacgtcatcg
cgattcctcatcttcgacaagtacgcagacatagtagcggagtaccagactgagtacccg
cagtactaccccgagccaggctggcatgagcaggacgcagacgagatcatggcaagctgc
gacgtctgtatcacagaagcttgcaaggcgctcgaagcggctggctggtcgaaagatagc
gtcaaggtcatcggaatcaccaatcagcgcgagacggcggtagcgtggagccggaagact
ggcaaaccgctgtgtcgcgcgatcgtgtgggacgatggaaggacgaagaacaccgtggcc
cacttcgagcgtaagctcgactatgtgggtctggaagtccagcctggcgtgttcaggaag
gccaagaacggcgaggccgccctcaaagaattagtaaggaccggcctgcagctatccaca
tacttctccgcgatcaagctacgatggatgatagaacatcaccagcaagtcaagaaggca
cacgaggaggatgatctccttttcggtacggtagaatcctggattgtctatgtacgcgac
cacagccctccgaacgatgcgcgctga

DBGET integrated database retrieval system