KEGG   Postia placenta: POSPLDRAFT_95617Help
Entry
POSPLDRAFT_95617  CDS       T01162                                 

Definition
hypothetical protein
Orthology
K07204  
regulatory associated protein of mTOR
Organism
ppl  Postia placenta
SSDB OrthologParalogGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 1791 aa AA seqDB search
MSSGQMYGNHYGNSRHNGWSGSHHHGPDEDTSTERDYRSTDPSPSRMRHMSGMADHNMRH
NGSVHTLSDPVPILPYWSAKRHLTCGNPTPPPPWAHKMAPWRSTSKLKTANAALVLCLNI
DVDPPDVVKTNPCAVLECWVDPHTLPAQKALDIIGTNLAHQFEGLSPKITFKPLLDPAYD
DLRKYCHSLRKTAKEDAILFYYNGHGVPKPTPSGEMWCFNKEYTQYIPVSLQEVQSWLLS
PCVYIWDCSAAGHLVNNFLTFAKRRDNDATLNRGGYPEGTPPFSESIQLAACAADEQLPS
CPELPADMFTSCLTSPIDIALRWFVMCRHLPDNITLDMVMQLPGDLKDRRTPLGELNWIF
TAITDTIAWTTFPRDLFTRLYRSDLLVASLFRNFLLAERIMKSYHCTPHTYPPLPATNTH
PLWASWDLAVDTCLRQLPELLKYMKPGSIPEGSLTSRRSTAARHPPTGPAEPPYTYIPSR
FFSDQLTAFEVWISRGGSALTKRGPLSLPETNGDPSQNLESVGEGVSLLPSDVDAVNDHH
LVPRKPPDQLPIVLQVLLSQPHRLRALILLSQFVDLGPWAVHLVLAIGIFPYISRLLQAA
SPDLRPVLIFIWARIFAVNPSCQVDLYGNQGYKYFANVLAERPDGGIPNSSEHKAMCAFV
LSAIARDYLQGQNACWREHVFDACCDALDDGDYLLRQWSALCIAQIWDGNDEIKMYGVDC
GTQDKLIALLNDDASEVRSAALYALGIFLGASGSQDLNKLGGGGSGTQLQLEERFHLRME
VAVVTGATLATKEDASPMVRKELLVLISCLVKEWRGYFIICAWIYWEEERGRMDPNHSRL
QEDDPASQAVAEWLDDFGDDDAFREESRVYLSSFFTIFAVLLELSVDPYQEVAANAQTIV
DYIVALLLESPFSGLQSTTLHDPPPHIVKGSTRGAQTRAPSLSSERNQQTPLSPYTSPYS
QPSTPPPSAPSQRSSPHPSPRSTAEVEHQPSNYSPSDVIKALIEEDTERLKARRRTASSH
HRHHHHGAVPGGGMSSPASSTFSMDSSIIMGIGTGLGIRDALPLKSRFYDWCCDYFKEPQ
MRQPETDEPGSVEYNYQIWRQQRNERVLVTTRQQAEIAPNRRWDRPVSTIQITGLPVNLA
FHSFDPHLIIANEHDTITVWDWMQRKRLSQFFNGNPQGTTITSLRLINQDVGGIILAASD
WKQTGGSLLVGGDSRVIRVWDAHTESQVMDMDTNSESPVTAIVSDEASTSTFLASFADGV
IKVFDRRMDEEDAVNVKWHPLLSGHFLSGSVDGEVKLWDIRGGEQALQTWDVHPHGLSAF
DVHDHTNVFVALIISHTICHPTLRRPPQATALPRFSQGSQVQAGLQGSQFEMVRAHTKQT
PDDKEKSHKKKSSSKKKSETGQWPCKINGCNKVFAREADLKRHQRTTKLHSMPGFHNGVI
IPPVEQDNVKNGDDGDGESSGSKSPSPDSPKRSGGEASSSKSVSRSTQPVSSGSGNYYRQ
HTMTTYPPRPGMIMEQHYPPSIGPPTSAARLHQATWHHPPPWPEGPPPPGMYPMGPPVPG
YYHSPYYRTPPGMIPYPPPHHYPPPVHMSPEFAHHSHMVNGMPYPQPYPPEERPASADGR
ESEGEEEASSQGSPPAIDPSLDGHTEALHPSAAEAAKGDKPPDGPSPEALAAIEVALATM
RARNEDMEDDVSGGDSAAQIDNEEAPSQEGGGGEEDGGQNIPPVGAVDEDKSDADAEMDV
DRSAEASSGSAEAAREQSTDEIVTEDGVTMLNPGIASIAPTLVNLQPSSFT
NT seq 5376 nt NT seq  +upstreamnt  +downstreamnt
atgtcctcaggtcagatgtacgggaatcactacggcaatagcagacataacggctggtct
ggcagccaccaccacggcccagacgaggacacctctactgagcgcgactatcggtctacg
gacccatcaccttcgcgaatgagacacatgagtggtatggcagaccacaacatgcgccat
aacggctccgttcacacactctccgaccctgtccccattctaccctactggtccgcaaag
cgtcacctcacatgcggcaacccaactccaccaccaccatgggcccataagatggcgccg
tggcggtcgacctcgaagctgaaaaccgccaacgctgcactcgtcctctgtctcaacata
gacgtcgaccccccggacgtggtcaagaccaatccgtgcgccgtgctagagtgctgggtc
gacccacacacactccctgctcagaaggctctggacatcatcgggacgaacctcgcgcat
caattcgagggattgagccctaaaatcacatttaagccgctcctggatcccgcgtacgac
gatttgcgcaaatactgccactcgctccgcaagacagcgaaggaggatgcaatcctgttt
tactacaacggccatggcgtcccgaagccgacaccgagcggggagatgtggtgcttcaac
aaggagtacacgcagtacatccccgtgtcgctgcaggaggtgcagagctggttgctctcg
ccttgcgtctacatctgggactgttctgcggcggggcacctggtgaacaacttcctcacc
ttcgcaaagcgacgggacaacgacgctaccctgaaccgaggcggctaccctgaagggaca
ccaccgttctcggaaagcatacagctcgcagcgtgtgcagcggacgagcagctcccatcg
tgccccgagttaccggctgatatgttcacgtcgtgtctcacatcgcctatcgacattgca
ttgcggtggttcgtgatgtgccgccatctaccagacaacatcacgctggatatggttatg
cagctacctggcgacctcaaggatcgccgaacgcccctgggggagctcaactggatcttc
accgctatcacggacaccattgcgtggacgacgttcccccgagatctctttacgcgattg
tatcggtccgacctgctggtagcatcacttttccgtaatttcttgctggcagagcgtatc
atgaagagctatcactgtacgccacatacatatcctccgctgccggctacgaacacacat
cccctgtgggcatcatgggacctcgcggtggacacttgtctgcggcaactaccagagttg
ctcaagtacatgaagcctggctcgataccggagggttcactcacgtcacggaggtccaca
gcagcccgccatcctccaacggggcccgcggaaccaccatacacatatattcctagtagg
ttctttagtgaccagttgaccgcttttgaggtatggatatctcgtggtggctcggcactg
acgaaacgtggcccgctatccctccccgaaaccaatggcgacccttcgcagaacctcgag
agcgtcggcgaaggtgtatcgctactgccgtcagacgtggatgccgtcaacgaccaccac
ctcgtgccgcgcaagccaccagaccaactgccgatcgtgctgcaggtcttgctctcgcag
ccgcatcgactgcgggctctcatactgctctcacagttcgtcgatctcgggccatgggct
gtgcacctggtgcttgccattggcatcttcccgtacatatcgcgtctgctgcaggctgcg
tcgccagatctgcggccggtgctgatcttcatttgggcacgcatcttcgcggtgaacccg
tcgtgccaggtggacctgtacggcaaccaggggtacaagtatttcgcgaacgtgcttgcg
gagcggccggatgggggcattccgaacagctcagagcacaaagcgatgtgtgcgttcgtg
ctgtctgccattgcacgcgactacctgcaagggcagaatgcgtgctggcgcgagcatgtg
ttcgatgcgtgctgcgacgctctggatgacggcgactacctgttgcggcagtggtctgcg
ttgtgcattgcgcaaatctgggacgggaacgacgagatcaagatgtatggcgtggattgt
ggcacgcaggacaagctcatcgcactactgaatgacgacgcgtccgaggtgcggagcgcg
gcgctatacgcgctcgggatattcctgggcgcgtcggggtcacaagatctgaacaagctt
ggtggtggcgggagcggcacgcagctccagcttgaggagcgcttccacttgcgcatggag
gtcgctgtggtcaccggagcgacgttggctaccaaagaagacgcgagtcccatggtgagg
aaggagctgctcgtccttattagttgcttggtgaaagaatggaggggctatttcatcatc
tgcgcttggatatactgggaggaagaacgcggaaggatggaccccaatcattccagactg
caggaggatgatcctgcgtcacaggcggttgcagaatggctggacgattttggcgacgac
gacgcattccgggaggagagccgggtatatctctcgtcgttcttcaccatcttcgctgtt
ctgctggagttatcggtcgatccgtaccaagaagtagccgcgaacgcgcagaccatagtc
gactacattgtagccctgctactcgagtcaccattcagcggccttcagagcacaactctc
catgatccacccccgcacatcgtgaaaggctctacccgcggggctcaaacccgtgctccg
tcgctttcctcagagaggaaccaacagaccccgttgtcaccgtacacatctccctactcc
caaccctccactcccccaccctctgcaccttcgcagcgctcctcgcctcacccatcaccg
cggtcaactgcggaggtggaacatcagccctcgaattactctccatcggacgttataaag
gctcttatagaagaagataccgagcgtttgaaggcgcgtcgcagaacagcttcttctcat
caccgacaccaccaccatggcgccgtcccgggaggcgggatgagtagccctgccagtagc
acgttctcaatggactcaagtatcattatgggcattggtaccggtcttggcattcgcgac
gcgctgcctctgaagagcaggttctatgactggtgctgcgactacttcaaggagccgcaa
atgagacaaccggaaaccgacgagcctggtagtgttgagtacaactaccaaatatggcgt
caacagcggaacgagagagtactcgttacaactaggcaacaggccgagattgcaccaaac
cgtcgatgggataggccagtgtctaccatccagataaccggtctgccagtcaacctggca
ttccactctttcgatccgcaccttataatcgcaaatgagcacgacaccataactgtctgg
gattggatgcagcgcaagagactaagccagttcttcaacggcaatccacaagggacgaca
atcacctcactgcgtttgatcaaccaggatgttggtggcatcatcctcgccgcatcagac
tggaaacagactggcggttcgttactcgtgggaggcgattcccgcgtgatccgcgtctgg
gatgcgcacaccgagagccaagtcatggatatggacaccaactcggaaagcccagtcaca
gcaatcgtctccgacgaagcgtcaacatcgacattcctagccagcttcgcagatggtgtc
atcaaggttttcgatcgacggatggatgaggaggatgccgtcaatgtcaaatggcatcct
ttgctgagtggacatttcttgtctggatcagtggatggtgaggtgaagctttgggacatc
cggggaggtgaacaagcactgcagacgtgggatgtgcatccacatggattgtctgcgttc
gatgtgcatgatcatacaaacgtgtttgtcgccttgatcatcagccacacgatttgccac
ccaacgctgcgccgccccccacaagccacagctctgccgcgcttctcccagggctcgcaa
gtccaggcaggtctacaaggttcgcaattcgaaatggtccgggcgcacacgaaacaaacg
cccgacgacaaagagaaatcacacaaaaagaaatcatcatctaagaagaaatcagagaca
ggccagtggccatgtaagataaacggctgtaacaaagtctttgcgagagaggcagacctc
aagcggcaccagagaacaacaaaattacattctatgcccggtttccacaacggcgtgatt
attccacccgttgagcaagacaatgtcaagaatggcgacgacggcgatggtgaatcctcg
gggtcgaagtctccgagccctgattcgccaaagagaagtgggggcgaagcgtcgagctcg
aaaagcgtgtcacgttctacacagccagtatcatctgggtcaggtaactactaccggcaa
cataccatgacgacataccctcctcgacccggaatgatcatggagcaacactatcccccg
tccatcggccctcccacatccgccgcgcgccttcaccaagctacctggcaccatccacct
ccatggcccgaaggccctcctcctcctggcatgtaccccatgggtcctccggttcctggc
tactaccactcgccctactaccgcaccccgcccggcatgattccgtaccccccgccacac
cactacccgccgcctgtgcacatgagccccgagtttgcgcaccactcgcacatggtgaac
ggcatgccgtatccgcagccatacccgccggaggagcgacctgcgtccgcagacgggagg
gagtccgagggcgaagaggaggcgtcgtcgcaaggatccccgcccgccattgacccatca
ctcgacgggcacacggaggcgctccacccgagcgctgcggaggctgctaaaggcgacaag
ccgcctgacggcccatcgcccgaagctttggcggcaatcgaggttgccctggcgaccatg
agggcgcgcaatgaggatatggaggacgatgtgtctggcggggactctgcggctcaaata
gacaatgaggaggcgccgtctcaagaaggcggcggtggggaggaggatggcgggcagaat
ataccgccggtgggtgctgtggatgaggacaaatctgatgcggacgcggagatggatgtg
gatagaagtgccgaggccagcagcgggtcagccgaggccgcccgcgagcagagtacggac
gagatagtcaccgaggacggcgttacgatgttgaatccaggaatcgctagcatcgccccc
accctcgtgaatctgcaaccctctagcttcacataa

DBGET integrated database retrieval system