KEGG   Postia placenta: POSPLDRAFT_98872Help
Entry
POSPLDRAFT_98872  CDS       T01162                                 

Definition
hypothetical protein
Orthology
K01698  
porphobilinogen synthase [EC:4.2.1.24]
Organism
ppl  Postia placenta
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    POSPLDRAFT_98872
Enzymes [BR:ppl01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.24  porphobilinogen synthase
     POSPLDRAFT_98872
Exosome [BR:ppl04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   POSPLDRAFT_98872
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
JGI: 
UniProt: 
AA seq 338 aa AA seqDB search
MAADNTMEISSILQGGYQHPLSRSWQARRHLTKSMLMYPIFITDDPDASVDIPSLPGQSR
WGVNRLDEFLGPLVKKGLTSVILFGVPLNCVKDERGTPADDPTGPVILAVRKLRALFPEL
YIACDVCLCEYTSHGHCGLFAADADTPGTLDQGPSAARIAEVALAYARAGAHCVAPSDMM
DGRIRAIKRAFIDAGFANRCTLMSYAAKFASALYGPFRDAAGSAPAFGNRKCYQLPPQAK
GLARRAIQRDVAEGADIIMVKPALPYLDVIQDAAQLAPDHPLACYQVSGEYAMVVAGARA
GVYDLRVMAFETVESMVRAGCTLILTYFTPQFLDWLSE
NT seq 1017 nt NT seq  +upstreamnt  +downstreamnt
atggccgcagacaacaccatggagatctcctccatcctccagggaggctaccagcacccg
ctctcccgctcatggcaggcccgtcgccatctcacaaagtccatgctcatgtatcccatc
ttcatcaccgacgaccccgacgccagcgtcgacatcccctccctcccgggccagagtcgc
tggggcgtcaaccgcctcgacgaattcctcgggcccctcgtcaagaagggcctcactagc
gtgatcctcttcggcgttcccctcaactgtgtcaaggacgagcgcggcacgcccgcagac
gaccccaccggccccgtcatccttgccgtgcgcaaactccgcgcgctcttcccggagctc
tacatcgcctgcgacgtctgtctctgcgagtacacctcccacggtcactgcgggctcttc
gccgcggatgccgacacgcccggcacgctcgaccagggcccctccgccgcgcgcatcgcc
gaggtcgccctcgcctacgcgcgtgcgggcgcgcactgcgtcgcccccagcgacatgatg
gacggccgcatccgcgccatcaagcgcgcgttcatcgacgccgggtttgccaaccgctgc
acgctcatgagctacgccgccaagttcgcgagtgccctgtacggtcctttcagagatgct
gcgggcagcgcccctgcgttcggaaaccgcaaatgctaccagctccccccgcaggccaag
ggcctcgcccggcgcgcgatccaacgcgacgtcgccgagggcgccgacatcatcatggtc
aagcctgcgctgccctacctcgacgtcatccaggacgccgcgcagctcgcgcccgaccac
ccgctcgcgtgctaccaggtcagcggtgagtacgccatggtcgtcgccggtgcgcgcgcg
ggcgtgtacgatcttcgtgtgatggcgttcgagaccgtcgagagcatggtccgcgcaggc
tgcacgctcatcttgacgtacttcacgcctcaattcctggactggctctcagagtga

DBGET integrated database retrieval system