KEGG   Postia placenta: POSPLDRAFT_99091Help
Entry
POSPLDRAFT_99091  CDS       T01162                                 

Definition
(GenBank) predicted protein
  KO
K01480  agmatinase [EC:3.5.3.11]
Organism
ppl  Postia placenta
Pathway
ppl00330  Arginine and proline metabolism
ppl01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppl00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    POSPLDRAFT_99091
Enzymes [BR:ppl01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.3  In linear amidines
    3.5.3.11  agmatinase
     POSPLDRAFT_99091
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Arginase
Motif
Other DBs
NCBI-ProteinID: EED77062
JGI: 99091
UniProt: B8PPY4
AA seq 144 aa AA seqDB search
MKSFSSLVTLSLFTLVAIAHDGHDHDTQMPLDYVKFPYEAVYPGDNEVTADSIFSGIATF
AKLPWVQCLGKDKTVPFDVAFIGAPFDTGTSYRPGARFGPAGIRAGSRRLTLYGGYNVPL
EVNPFLSGLKIVDCGDIPVTPYDN
NT seq 434 nt NT seq  +upstreamnt  +downstreamnt
atgaagtcattctcctctctcgtgactctttccctattcactctcgtcgctattgcgcac
gacggacatgaccatgatactcagatgccgctcgactacgtcaaattcccctacgaggcc
gtgtatcccggcgacaatgaagtgaccgctgattctatcttttctgggatcgctacgttt
gccaagctgccgtgggttcagtgtctcggcaaggacaaaacggtcccattcgatgtcgcc
ttcatcggagcgccgttcgatacaggtacttcctatcgcccgggtgctcggttcggtcct
gcgggcattcgcgccggatctcgtcgtcttacgctctatggaggctacaacgtgccgctc
gaagttaatcccttcctatcgggcctcaagatcgtcgactgcggtgacattccagtcacg
ccttacgacaacaa

DBGET integrated database retrieval system