KEGG   Paenibacillus polymyxa SC2: PPSC2_c0034Help
Entry
PPSC2_c0034       CDS       T01335                                 

Definition
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase
Orthology
K00919  
4-diphosphocytidyl-2-C-methyl-D-erythritol kinase [EC:2.7.1.148]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Terpenoid backbone biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Module
C5 isoprenoid biosynthesis, non-mevalonate pathway
Class
Metabolism; Metabolism of terpenoids and polyketides; Terpenoid backbone biosynthesis [PATH:ppm00900]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
35465..36319
Genome map
AA seq 284 aa AA seqDB search
MKIYEKAPAKINLMLDVLRKRDDGYHEVEMIMTMVDLSDRLTMSELPRDTIIISSQAGYI
PLDEKNLAFQAARLIKERYNVSTGVHIHLDKHIPVAAGLAGGSSDAAAALRGLNKLWKLG
ISDAELRVLGAELGSDVPFCITGGTALASGRGELLKPLPNPPQCWVILAKPPINVSTAEV
YGRVKADQITHHPSARQMEQAIRNASFTDVCNTLGNVLEDVTLKLYPEVEHLKNSMIRLG
ADGVLMSGSGPTVFGLVSKEAKVPRIYNGLRGFCKDVYAVRLLT
NT seq 855 nt NT seq  +upstreamnt  +downstreamnt
ttgaaaatatatgaaaaagcaccggcgaaaattaatttaatgcttgatgttctacgtaag
cgggacgatggttatcacgaggtcgaaatgattatgactatggtcgatctatccgaccga
ttgacgatgtccgagttaccgcgtgataccattattatttcaagccaagccgggtacata
ccgttagatgaaaagaacttggcttttcaggctgcgcgtctgatcaaagaacgttataac
gtgtctacaggcgtccatatccatctggataagcatatcccggtggctgcaggattagca
ggcggaagcagcgatgctgccgcagcattgcgtgggctgaacaagctgtggaaacttggt
atctcggatgcggaattaagggtactgggtgctgaattgggttcagacgtacctttctgt
attacagggggcacagctttagcgagcggacgtggagaactgcttaaaccactgccgaat
ccgccacaatgctgggtgatcctcgccaagccgccgattaatgtatcgacagctgaagtg
tatggtcgtgtcaaagcggatcagattacgcaccacccgtctgcccggcagatggagcag
gcgattcgtaatgcttcttttaccgatgtatgcaataccctggggaatgtactggaggat
gtgacattaaagctgtatccagaagtggagcatcttaaaaactccatgatccgtttagga
gctgatggggtgctgatgtcaggtagcggacctacagtgttcggactggtatcgaaggaa
gccaaagtgccacggatctataacggactaagaggcttttgcaaagatgtttacgcagta
cgacttttgacctga

DBGET integrated database retrieval system