KEGG   Paenibacillus polymyxa SC2: PPSC2_c0072Help
Entry
PPSC2_c0072       CDS       T01335                                 

Definition
2-amino,4-hydroxy, 6-hydroxymethyldihydropteridine pyrophosphokinase
Orthology
K00950  
2-amino-4-hydroxy-6-hydroxymethyldihydropteridine diphosphokinase [EC:2.7.6.3]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Folate biosynthesis
Metabolic pathways
Module
Tetrahydrofolate biosynthesis, GTP => THF
Class
Metabolism; Metabolism of cofactors and vitamins; Folate biosynthesis [PATH:ppm00790]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
74201..74749
Genome map
AA seq 182 aa AA seqDB search
MNAHSTSEASEAYIALGANLGEREHTLYEAITALDEHPAIRVVRCSSLYETEPVGYLDQP
SFLNMTVAVSTTLAPEELLFYMLEVESRLGRVRHIPNGPRTIDLDLLWMEATQLATPDLE
LPHPRMLERAFVLVPLADIVPSQDSSGLYSIVHTALNSVDGKDGIQLWKTCSWRNDSAPF
GS
NT seq 549 nt NT seq  +upstreamnt  +downstreamnt
atgaatgcacattcgacctctgaggcatcagaggcttatattgctttaggggctaatttg
ggggagcgtgagcataccctgtatgaagccattaccgcactggacgaacatcctgcgata
cgagtggtgcgctgctccagtttgtacgaaacagagcctgttggatatctggatcagcct
tcttttttgaatatgacagtagccgtctctacaacacttgctccagaggagcttttgttt
tatatgctagaggtggagagtcgtctggggagggtaaggcatattcctaacggtccacga
accattgatctggacttgttgtggatggaagcgacacaactggctacgccagatttggaa
cttcctcatcctcgtatgctggagcgtgcttttgtgctggttcctctggctgacattgtt
ccgagccaagattcgtccggtctgtacagtatcgtgcatacagcattgaattctgtggat
ggaaaggacggcatacagctttggaaaacttgcagctggcgcaacgactccgcgcctttc
ggaagctaa

DBGET integrated database retrieval system