KEGG   Paenibacillus polymyxa SC2: PPSC2_c0114Help
Entry
PPSC2_c0114       CDS       T01335                                 

Definition
phosphoglycerate mutase
Orthology
K01834  
2,3-bisphosphoglycerate-dependent phosphoglycerate mutase [EC:5.4.2.11]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Glycolysis / Gluconeogenesis
Glycine, serine and threonine metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPSC2_c0114
   01230 Biosynthesis of amino acids
    PPSC2_c0114
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPSC2_c0114
  Energy metabolism
   00680 Methane metabolism
    PPSC2_c0114
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPSC2_c0114
Enzymes [BR:ppm01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.2  Phosphotransferases (phosphomutases)
    5.4.2.11  phosphoglycerate mutase (2,3-diphosphoglycerate-dependent)
     PPSC2_c0114
Exosome [BR:ppm04147]
 Exosomal proteins
  Exosomal proteins of bladder cancer cells
   PPSC2_c0114
  Exosomal proteins of melanoma cells
   PPSC2_c0114
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
142730..143275
Genome map
AA seq 181 aa AA seqDB search
MKKIYFVRHAQATGQEPDARLTDEGKRQAEQLADFMENVGVEYIVSSPWKRAVRTIQPLA
ERRHLQVYTDLRLQERVLCRDHLDHWLDVLEQTYLDEDLKLEGGESSREAADRGIQLVQE
LIERAEKTVIIVTHGALLSLLIRHYDPQFGFEEWKKLSNPDVYLLELNEAEAKIHRVWNI
D
NT seq 546 nt NT seq  +upstreamnt  +downstreamnt
gtgaagaaaatttattttgttagacatgcccaagcaactggacaggaaccagatgcccga
ctcaccgatgaaggtaaacgacaagctgagcagttggctgattttatggagaatgtaggt
gtggaatatattgtgtccagtccatggaaacgggccgtgcgaaccattcagcccttggct
gagcgtagacatttgcaggtatatactgatctacgtcttcaggaacgtgtactatgccgt
gatcatctggatcattggctggacgtgctggaacagacatatctggacgaggacttgaag
ctggaaggaggagaatcatcccgtgaagcagcagatcgaggaatccagcttgttcaggag
cttatagagcgggcggaaaaaacggttatcattgtaactcatggagctttactctctctt
ctcattcgacattacgatccgcagtttggttttgaggagtggaaaaaactatccaatccc
gacgtgtatttgctagaactgaatgaagcagaagccaagattcacagagtgtggaatata
gattga

DBGET integrated database retrieval system