KEGG   Paenibacillus polymyxa SC2: PPSC2_c0146Help
Entry
PPSC2_c0146       CDS       T01335                                 

Definition
UDP-N-acetylglucosamine 1-carboxyvinyltransferase 2
Orthology
K00790  
UDP-N-acetylglucosamine 1-carboxyvinyltransferase [EC:2.5.1.7]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Amino sugar and nucleotide sugar metabolism
Peptidoglycan biosynthesis
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ppm00520]
Metabolism; Glycan biosynthesis and metabolism; Peptidoglycan biosynthesis [PATH:ppm00550]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
172681..173934
Genome map
AA seq 417 aa AA seqDB search
MEKLMITGGRPLQGTVSISGAKNSAIALIPAAILAESEVILDNLPLLSDVAVYSEILEEL
GAKVAWEGSQMKIDPSSIKSIPMPNGPVKKLRASYYMMGAMLGRFKEAIIGLPGGCNFEP
RPIDQHIKGFEALGATVTNEHGAIHLHAKELRGTKIYLDVSSVGATINIMLAAARAKGAT
TIENAAKEPEIIDVATLLNSMGAIIKGAGTETIRIEGVSELHGCRHSIIPDRIQAGTYMI
AAAATRGNVLIDNVIPKHMEALTAKMQEMGIGIEEYDESIRVLGAPSYGHVDVKALVYPG
FPTDLQSPMTSLLTQAQGVSVLSDFVYSNRFKHVPELVRMGAKIRVEGRSAIIEGGQLNA
AKVKAADLRAGAALVIAGLTVSEGVTEVAGVEYIDRGYDHLVSNLRLLGADVWRQTE
NT seq 1254 nt NT seq  +upstreamnt  +downstreamnt
atggaaaaattgatgatcaccggtggacggccgcttcagggtacagtttccatcagcggt
gccaaaaacagtgccatcgccttgattcccgcagccattctggcagagtcggaagtcatt
ttggataatttgccgctgctcagtgatgtggcggtgtattccgagatattggaggagctt
ggcgcaaaggttgcctgggaaggtagccagatgaagatagacccttcctccattaaatcc
attcctatgccgaatggacctgttaagaaattacgagcctcttattatatgatgggggcc
atgctgggcagattcaaggaagcgatcatcggtttgccaggaggatgtaattttgaaccc
cggcccattgatcagcatatcaaaggttttgaggcgctgggtgccacggttacgaacgag
cacggcgctattcatttgcacgccaaagaactgcgcggcaccaagatttatttggatgtc
agcagcgtaggagcaaccattaatattatgctggcggccgcacgtgccaaaggcgccaca
actatcgaaaatgcggctaaagagcctgagattatagatgtagcaactctgttaaactcc
atgggggcgattattaaaggcgctggaacggagacgattcgtattgaaggtgtgtcggag
ctgcatggctgccgtcattccatcatacctgaccgtatacaagcaggcacatatatgatt
gctgctgcggcaacccgtggaaatgtattgattgacaatgtaatccccaaacatatggag
gctctcactgccaaaatgcaggaaatgggcatcggcatcgaggaatatgatgaaagtatt
cgcgtactgggtgcaccttcctatgggcatgtcgacgttaaagccttggtataccccggc
ttccccacggatttacaatctcccatgaccagcttgctaacccaggctcagggtgtcagt
gtgttgagcgattttgtgtacagcaatcgttttaagcacgtccctgaactggtgcgaatg
ggggctaaaattcgcgtagagggtcggtctgccattattgagggtggtcaactgaatgcg
gctaaagtgaaggctgcagatctgcgcgctggagcggcccttgtcattgctggacttaca
gtaagcgaaggggtaaccgaggtggcaggtgtcgagtatattgaccgtggttatgatcat
ctcgtttccaacctgcgtcttttgggcgcagatgtgtggcggcagactgagtaa

DBGET integrated database retrieval system