KEGG   Paenibacillus polymyxa SC2: PPSC2_c0153Help
Entry
PPSC2_c0153       CDS       T01335                                 

Definition
recombination protein recr
Orthology
K06187  
recombination protein RecR
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Homologous recombination
Class
Genetic Information Processing; Replication and repair; Homologous recombination [PATH:ppm03440]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
179915..180514
Genome map
AA seq 199 aa AA seqDB search
MHYPEPIAKLIDAFTRLPGVGPKTAARLAFHVLKMKEDDVIDFAKALVNVKRNLHFCSVC
GNITDTDPCRICQDKTRDASVICVVQDAKDLVAMERTKEFEGLYHVLHGAISPMEGIGPE
DIKLKELLTRLSDERVKELILATNPNIEGEATAMYISRLVRPFEIKVTRIAHGLPVGGDL
EYADEVTLSKALEGRRELN
NT seq 600 nt NT seq  +upstreamnt  +downstreamnt
ttgcattatcccgagccgattgcaaagctgattgatgcttttacgcgcctgccgggagta
ggccccaaaacagctgcccggttggcttttcacgtactgaaaatgaaggaagatgatgtg
attgattttgccaaagcgctggtcaatgtaaaacgcaatcttcacttttgttcagtctgc
ggtaacattacagatacggacccttgtaggatctgtcaggataagacgagggatgcttcc
gtcatttgtgttgttcaggatgctaaggatttggtcgctatggagcgtaccaaggagttt
gagggtttgtaccatgtacttcacggggcaatctctccgatggagggaattggccctgag
gatatcaaactcaaggagttgctgaccaggctaagtgatgaacgtgtcaaggagttgatc
ctggctacgaatccgaacattgagggagaggccacggctatgtacatttcgcggctagtg
cgtccttttgaaatcaaggttactcgtattgctcacggtttgcccgtgggcggggatttg
gagtatgccgacgaggtcaccctgtccaaagcgctagaaggccgcagagagcttaattag

DBGET integrated database retrieval system