KEGG   Paenibacillus polymyxa SC2: PPSC2_c0167Help
Entry
PPSC2_c0167       CDS       T01335                                 

Definition
histidinol dehydrogenase 2
Orthology
K00013  
histidinol dehydrogenase [EC:1.1.1.23]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Histidine metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Module
Histidine biosynthesis, PRPP => histidine
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PPSC2_c0167
  Amino acid metabolism
   00340 Histidine metabolism
    PPSC2_c0167
Enzymes [BR:ppm01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.23  histidinol dehydrogenase
     PPSC2_c0167
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
197181..198494
Genome map
AA seq 437 aa AA seqDB search
MKIVAARDFNLQREVDYGTPEQNEAVRTIIQSVRQEGDEAVLRYTEMFDGVSLTAEQLRV
TDGELKLAYDKVEPSFIQAIREAAAHIRAFHTKQKRNSWIDLQSDGSLLGQIIRPLKRVG
VYVPGGKAAYPSSVLMNVIPAQVAGVPEIVMVTPPATGGKAGIDPYTLVAAAEAGVTEIY
RVGGAQAIASLAYGTHSIEPVDKICGPGNIYVALAKREVYGAVDIDSIAGPSEIVVLADD
TANPSYVAADLLSQAEHDEMASAILVTPSQRLAEEVSAEVQRQLAELPRRDIAAASVEAY
GAIIVVDNLEEGIRIVNRLAPEHLEIMTEQPMEHMGQIENAGAIFLGAYSSEPVGDYFAG
PNHIIPTNGTARFSSPVDIDDFIKKSSMIYYSKEALLRNGETIMQLARHEGLEGHARAIQ
VRLDNEKKAVDGDGERK
NT seq 1314 nt NT seq  +upstreamnt  +downstreamnt
atgaagatcgtagcagcccgtgatttcaatctccaacgagaggtagattacggaacacct
gagcaaaacgaggctgtgcgtacgattattcaatcggtacgccaagagggagatgaggct
gtcctgcggtatacagaaatgtttgacggtgtatcgctgacagcggagcagcttcgtgtg
acagatggagaattaaagttggcctatgataaggtagagccttcatttatacaggcgatt
cgagaagcggccgctcatattcgcgcttttcataccaagcaaaagcgtaactcatggata
gatttacaatcagatggtagcttgctcggtcaaatcatccgaccattgaaacgtgtaggc
gtgtatgttccaggtggtaaagctgcctatccttcctcggtattgatgaatgttattcca
gctcaagtggctggagtaccggagatcgtcatggtgacacccccggcgacaggcggcaag
gcagggatcgacccctatacactggtagctgcggcagaggctggtgtaacggaaatatac
agggttggcggagcgcaggctattgcctctcttgcatacgggacacatagtattgaaccg
gttgataaaatttgcggtcccggcaacatttatgtagcgctggcgaagcgagaggtatac
ggtgcagtggatatcgacagtattgcgggaccgagtgaaattgtcgtattggcagacgac
acggcgaatccctcttatgtagcggccgacctactttcacaggcggaacatgacgaaatg
gcctcagccattctggttacgccttcgcaacgcttggccgaagaagtatcagccgaggta
cagcgccaattggcggagttgccgcgcagagatatcgctgctgcatcggtggaggcatac
ggagccatcattgtcgttgacaatttggaagagggcatccgtattgtcaaccggcttgcg
ccagagcatttggagatcatgacggagcagccgatggagcatatggggcagattgaaaat
gcgggagctatttttctgggagcgtacagctcagagccggtaggcgattattttgccgga
cctaatcacatcattccgacgaatggaacagcacgcttttcttcgccagtggatattgat
gattttatcaagaagtcgagtatgatctattacagcaaggaagcactgctgcgcaatgga
gagaccattatgcagcttgcccggcatgaagggctggaaggccacgcacgggcgatacaa
gttcgattggacaatgagaagaaggcggtggatggcgatggggaacgaaaataa

DBGET integrated database retrieval system