KEGG   Paenibacillus polymyxa SC2: PPSC2_c0188Help
Entry
PPSC2_c0188       CDS       T01335                                 

Definition
(RefSeq) triosephosphate isomerase
  KO
K01803  
triosephosphate isomerase (TIM) [EC:5.3.1.1]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Glycolysis / Gluconeogenesis
Fructose and mannose metabolism
Inositol phosphate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of antibiotics
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Glycolysis, core module involving three-carbon compounds
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPSC2_c0188
   01230 Biosynthesis of amino acids
    PPSC2_c0188
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPSC2_c0188
   00051 Fructose and mannose metabolism
    PPSC2_c0188
   00562 Inositol phosphate metabolism
    PPSC2_c0188
Enzymes [BR:ppm01000]
 5. Isomerases
  5.3  Intramolecular oxidoreductases
   5.3.1  Interconverting aldoses and ketoses, and related compounds
    5.3.1.1  triose-phosphate isomerase
     PPSC2_c0188
Exosome [BR:ppm04147]
 Exosomal proteins
  Exosomal proteins of colorectal cancer cells
   PPSC2_c0188
  Exosomal proteins of bladder cancer cells
   PPSC2_c0188
  Exosomal proteins of melanoma cells
   PPSC2_c0188
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
217696..218448
Genome map
AA seq 250 aa AA seqDB search
MRTPIIAGNWKMFKTVPEAKTFIEEIKGKAEVAGVESVICAPFTNLPALVEAVKGTSIKI
GAQNLHFAEDGAFTGEISGGMLKDLGVDYVVIGHSERREYFNETDETVNKKVHAAFRHGL
TPIVCVGEKLEDREAGQTKEVVKVQTVAAFAGLAKDQAAQVVVAYEPIWAIGTGKSSTSQ
DANEVISYIRSLIKELYDENTASAVRIQYGGSVKPENVTEYLGQSDIDGALVGGASLQPA
SYIALVEGAK
NT seq 753 nt NT seq  +upstreamnt  +downstreamnt
ttgagaacaccgattatcgcgggtaactggaagatgttcaaaaccgtaccagaagctaaa
accttcatcgaagagatcaaaggtaaagcagaggttgcaggagtggagagcgttatatgt
gctccatttacaaatcttcctgctctggttgaagcagtaaaaggcacatctattaaaatc
ggcgcacaaaacctgcactttgcagaagatggcgcatttacaggtgaaatcagcggcgga
atgcttaaagatctgggcgtagactacgttgtgatcggacactccgagcgtcgtgagtat
ttcaacgaaacagacgaaacggtgaacaaaaaggttcatgcagcattccgtcatggcctg
acaccaattgtatgtgtaggcgaaaagctggaagaccgtgaagcaggtcaaaccaaagaa
gttgtaaaagtgcaaactgtagcagcttttgctggtctggctaaagatcaagcagcacaa
gtcgtagttgcttatgagccaatctgggccatcggaacaggcaaatcctctacttcgcag
gatgcgaatgaagtgatttcctacatccgtagtctgattaaagagctgtatgatgaaaat
acagcaagtgctgtacgtattcagtacggtggtagtgtaaaacctgaaaatgttactgag
tacctgggtcaaagcgatatcgacggcgcgctcgtgggcggtgccagtcttcaaccggcg
tcgtacatcgcgcttgttgagggggcgaagtaa

DBGET integrated database retrieval system