KEGG   Paenibacillus polymyxa SC2: PPSC2_c0234Help
Entry
PPSC2_c0234       CDS       T01335                                 

Definition
asparagine synthetase [glutamine-hydrolyzing] 2
Orthology
K01953  
asparagine synthase (glutamine-hydrolysing) [EC:6.3.5.4]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ppm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(271859..274093)
Genome map
AA seq 744 aa AA seqDB search
MCGIAGVVRLDGTSLSQNVDTILQNMAEEISYRGPDDEQFFIKGPLGFAFRRLSIVDING
GKQPLTNEDGTIVLIANGEIYNSTELRAKLSSRHQYKTNSDCEIILHLYEEKGIDLLQDL
IGMYAFALWDSRKQKMFIARDRFGIKPLFFTANRERLVFASEIKSLMKYPDCPRSLDWNK
ALTDPWLSGYTATDLSDPSSFFEGIEHLPAGCAVEVDVKKGSWKQIRYWDLLANNNQSFA
ELSDQEIINYYANLLEDSVQKCLQSDVEIGLFLSGGIDSASIAAITSERQNIHTFSVLSQ
STLTNEDAKYAHITAKYLGLPNHQVLFHWDENDFEPNHWRKLLWLCESPLCGPEQLYKFH
LHRYARSVCPDLKVILTGQGSDEFNGGYSSVLAPAWENNWEGFTKNLNRLEMGRYMSNLP
SKLFVWEEHFEQSPLSEKFILSKSSEVRRESSWEAYILTKFRDIQMYNCWLEDRIAAGNS
IENRVPFLDHRIVEFALSIPSARRKGLFWDKKLLRSGIQNRLPSELYKRSKVPFFYGEDA
RFTLRMMLDLLLKQKSVLLEEAVASSKFSDFIDTDAFFSIAQQLSQDPEVTNMEYFLRIV
NMGLLQHMVEQTNVKYEDSDNFIILSNHPIENWEKNEEEIHLKLSKRREAIKLEDIPLFA
PEVFLVQRDDIQKDNHAYLVVDNHLTYALSEDEAGQWLRVLRKINGEQSLKEILSDLDIT
ESEIRKFLEEAIDFGVITMKPIAN
NT seq 2235 nt NT seq  +upstreamnt  +downstreamnt
atgtgtggaattgctggtgtagttagattagacggtacctctttatcccaaaatgtagat
actatattgcaaaatatggccgaagaaatttcatatagaggacctgatgatgaacaattc
tttataaaaggacctttgggtttcgctttccgtaggctttcaattgtagatattaatgga
ggaaagcaacctcttacaaatgaggacggtacaattgtgctaattgctaatggggagatt
tataacagtacggagttaagagcaaaattatcttcaaggcatcaatacaaaactaattca
gattgcgaaattatcttgcatttgtatgaagagaaaggaatagatctacttcaagattta
attggtatgtatgcatttgctctttgggattctcggaagcaaaaaatgtttatagcacgg
gaccgttttgggatcaagccattattttttactgctaaccgtgagagattggtatttgct
tcggaaataaaatcattgatgaaatatcccgattgtccacgatctcttgattggaataaa
gctttaactgatccatggttgagtggctataccgcaactgatctatcggatccttcttca
ttttttgaagggatagagcatttaccagctggatgtgcagtagaagtcgacgttaagaag
ggcagttggaagcaaattcgctattgggatttattagcgaacaataatcaatcatttgca
gaactcagcgatcaagaaattattaattattatgccaatttacttgaagattcggtccaa
aagtgtttgcaaagtgatgttgaaattggattattcctaagcggggggatcgattcggcg
tccattgctgcaataacatcagagcgacaaaatatccatacattttcagtgttaagccag
agcaccctaacgaatgaagatgctaagtatgcacatattactgctaagtacttaggactt
ccaaatcatcaagtcttatttcattgggatgagaatgacttcgaaccaaaccattggaga
aaattgttatggttatgtgaatcaccactttgtggtccagagcagttgtacaaattccat
ttacatcgctatgctcgctctgtttgccccgatctaaaagtaattttaactggtcaggga
agtgatgaatttaacggtggttacagtagtgttttagctcctgcttgggagaataattgg
gaagggtttacaaaaaatcttaaccgtctagaaatgggaagatacatgagtaatttacca
tctaaactctttgtctgggaagaacactttgagcaatcaccactctcagagaaatttatt
ttatctaagagcagtgaggttcgtagggaaagttcttgggaagcctacatattaacgaag
tttagagatatccaaatgtataattgttggcttgaggatagaatagctgcgggtaatagt
attgaaaatcgtgtaccctttctcgatcaccgaattgttgaatttgctctatctatcccg
tccgctaggcgaaagggacttttttgggataaaaaattactacgatcaggcattcaaaac
cgactcccctcagaattatataagagatctaaagtaccattcttttatggtgaagatgca
aggtttacacttcgtatgatgctggatctcttattaaaacagaagagcgtattacttgaa
gaagcagtggcttcctccaaattttctgattttatcgatactgatgctttcttctcaata
gctcagcagctatcacaagacccagaggtaactaatatggaatattttctccgtatagta
aatatgggtttattgcagcacatggttgagcaaacgaatgttaagtatgaagactcagac
aattttattattctttctaaccatcctattgaaaactgggagaaaaacgaagaagaaatt
cacttgaaattatccaaacgccgtgaagcaattaaattagaggacattcctttatttgct
ccagaagtatttttggtgcaacgagatgacattcaaaaagataatcatgcctatttagtt
gtggataaccatcttacatacgctctttctgaagatgaagccgggcagtggttacgggtt
ttaaggaaaataaacggggaacaatctttgaaagaaattttgtctgatttagatataact
gaatctgagattagaaaatttttagaagaagcaattgactttggtgttataactatgaaa
ccaattgctaactaa

DBGET integrated database retrieval system