KEGG   Paenibacillus polymyxa SC2: PPSC2_c0376Help
Entry
PPSC2_c0376       CDS       T01335                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Carbohydrate metabolism; Pentose and glucuronate interconversions [PATH:ppm00040]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppm00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppm00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ppm00520]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(427861..428742)
Genome map
AA seq 293 aa AA seqDB search
MRKITKAVIPAAGLGTRFLPATKALPKEMLPIVDKPAIQYIVEEAIKSGIESIIIVTGRN
KKAIEDHFDKSVELEQVLESKGKYDLLREVQSIGGKAVIHYIRQKEPLGLGHAVRCARQF
IGDEPFAVLLGDDIMNSSTPAIRQMMDVYEATGKQVVGVRTVEEQDVSKYGIIGSTHQNG
LIHEVGGLVEKPSPADAPSRQAVIGRYVLEPSIFSILENMSTGAGGEYQLTDALHQVALQ
NQLLALELEGTRYDIGDKAGYLEAVLHMGMQREDLRPMLDSMMREWALASMIK
NT seq 882 nt NT seq  +upstreamnt  +downstreamnt
atgagaaaaattacaaaagccgttatccctgccgccggtttgggaacccgttttttgcca
gctacgaaagctttaccaaaagagatgcttccaatcgtagataaaccagccattcaatat
atcgttgaagaagccatcaaatctggaattgagagcatcattatcgttacggggcgtaat
aaaaaagccatcgaagaccattttgacaagtctgtagagctggagcaagtactggagagc
aagggaaaatatgatcttctgcgtgaagttcaaagcatcggaggcaaggcagtcatccac
tatatccgtcaaaaagaaccgctcggcttgggacatgcggtacgctgcgcccgtcagttc
attggcgatgagcccttcgccgtgttattgggcgatgatattatgaattcctccactccg
gcgattcgtcagatgatggatgtatacgaagccactggcaagcaagtggtcggcgtgcgt
acggtagaagaacaggatgtaagtaaatacggcattattggctccactcaccaaaatggc
cttattcatgaagtcggcggacttgttgaaaaaccatccccggcagatgctccttcgcgg
caggctgtcattggtcgctatgtattggagccttctattttctccatattggagaacatg
tccactggagcgggcggtgaataccaattgacagatgctctgcatcaagtagcattgcag
aaccaactgcttgcattggaactggagggcacacgctacgatattggtgataaagctggc
tatctggaagcagtgctccacatgggcatgcagcgcgaagatttgcgtccaatgcttgac
tccatgatgcgtgagtgggcacttgcttcaatgataaaatag

DBGET integrated database retrieval system