KEGG   Paenibacillus polymyxa SC2: PPSC2_c0396Help
Entry
PPSC2_c0396       CDS       T01335                                 

Definition
transcriptional regulator
Orthology
K00845  
glucokinase [EC:2.7.1.2]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Glycolysis / Gluconeogenesis
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Streptomycin biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Class
Metabolism; Overview; Carbon metabolism [PATH:ppm01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppm00010]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppm00052]
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppm00500]
Metabolism; Carbohydrate metabolism; Amino sugar and nucleotide sugar metabolism [PATH:ppm00520]
Metabolism; Biosynthesis of other secondary metabolites; Streptomycin biosynthesis [PATH:ppm00521]
Metabolism; Biosynthesis of other secondary metabolites; Butirosin and neomycin biosynthesis
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
453100..454038
Genome map
AA seq 312 aa AA seqDB search
MVAVALNKVIGIDIGGTSVKAAIVARDGSVLDEIRMDTDASRGRDWVLSRVSDSVFGLMC
SFGDTSVSTPVGIGALGIATAGRVNVESGEVVYATDNLPGWQGTSLVRWAREKLALRAVA
DNDANAALLGEAWQGAGKGKQRLAMLTLGTGVGGAYMENGLLCRGAHWSGGDWGHSILFP
GGHPCNCGKKGCAEQYVSGSALLRRGSECTGKLYCSGNEIVEEAAHGNLKTIQALDDYTA
DLAVLLANISVTLDPELIIVGGGVADAGDVWWPLLEKHLDRLGVQTEVSRAMLGNRAGFI
GAARLAFEMTES
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
gtggtggcagttgcattgaacaaagtcattgggatcgacattggagggacttctgtaaag
gccgccatagtggcacgggatggatctgtacttgatgaaattcgaatggatacagatgcc
tcccgtgggcgtgactgggtgttgtcgcgtgtatctgattctgtattcggactgatgtgt
tcttttggggataccagtgtgagtacccctgtaggtataggcgctttaggtattgctact
gctggcagagtgaatgtggagagcggtgaagttgtgtacgctacagataacctacctggc
tggcagggtacatccttggtgaggtgggctagagaaaagcttgctttacgtgcggttgct
gataatgatgcgaacgctgcgttacttggagaagcttggcagggggccgggaagggtaag
cagcgcctagccatgctcaccttgggaacaggggtcggaggcgcgtatatggaaaatggc
ctcttgtgtagaggtgctcattggagcggcggcgattgggggcacagtattttgtttcct
ggaggtcacccctgcaattgcgggaaaaagggatgtgctgagcaatacgtatcaggtagc
gccctgttacgtcgaggtagtgaatgcaccggaaaactgtattgttctgggaacgagatt
gtggaagaggccgctcacggcaacctgaagacaattcaggcgctagatgactacacagca
gatttagctgttcttctggctaatatatcggtgactcttgatcctgagttgatcattgtt
gggggaggagtagcggacgcgggagatgtctggtggcccttgctggaaaagcatctggac
cgactgggagttcaaacagaagtaagtcgggcaatgttaggaaaccgcgctggattcatt
ggcgctgccaggcttgcttttgagatgacggaatcttag

DBGET integrated database retrieval system