KEGG   Paenibacillus polymyxa SC2: PPSC2_c0663Help
Entry
PPSC2_c0663       CDS       T01335                                 

Definition
family 2 glycoside hydrolase
Orthology
K01190  
beta-galactosidase [EC:3.2.1.23]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Galactose metabolism
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PPSC2_c0663
  Lipid metabolism
   00600 Sphingolipid metabolism
    PPSC2_c0663
  Glycan biosynthesis and metabolism
   00511 Other glycan degradation
    PPSC2_c0663
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PPSC2_c0663
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
749913..752255
Genome map
AA seq 780 aa AA seqDB search
MGSRVIMPFRTDWTFVEGNYTGAEKTDYNDGHWRDLHLPHDWSIEKSFDPHMPYGGNQAY
LPRWSVGWYRKHFNVEPSSPKQRVYIQFDGIHSNSEVWLNGHFVGKRPYGYVSFQYDLTP
YIRWDEENVIAVKVGNTLLPPDRWYSGAGIYRNVWLIYTDYLHITEWGTYITTPEISPDE
AKVSARIQVSNHYAHAVECTIMTEILDSQGQLKGKIENRVTLAGLESEEIEQKTRVLEPE
LWSPDHPVLYEAQTTIYCDNTEVDRYRTPFGIRKVILDSQKGLLLNGSSLKLKGVCIHHD
LGCLGAAYHDTAMKRRLEKLKEMGCNSIRFAHNPMAPELLDLCDQMGFLVVDEAFDKWKS
LSYEHLYDEWWEKDLETMLVRDRNHPSVLMWSVGNEVENQGQPSMLNMLEKLVAFCHKKD
PTRPVTCALEPHNTPISLRDGSIESKVEHTKLLAQRVDVLGLNYQEQWYEHYRAAMPDTL
ILGTETFPYYRGKDNRVKGYLPLNPWFDVANHDYVIGQFVWSGIDYLGETSYPSKGWSSG
LIDTCGFRKPVSYLQQSLWSDQPVVHIAVFNDHMKSEYNPTWTMHWKSPTMEDHWTFPEY
AGKLIGLVTFTNCESVELIVNEESYGERKLTDFPNHLILWELPYTPGKIRAIGRNGNQQV
CEHELTTAGLPYALKLEANRAILPADGHEISHVEVTVIDQHGIVVPNQDVDLSFELHGDG
RILGIDNGDLTSDEPYKGKERRTHRGRCLVIVQSGDVAGELLLQASADGELQGEVSLKVE
NT seq 2343 nt NT seq  +upstreamnt  +downstreamnt
atgggaagcagagtgattatgccgttcagaacagattggacattcgtagagggcaactac
acaggtgctgagaagacagattataacgatgggcattggcgggaccttcatctccctcat
gattggagtattgaaaaatcgtttgatccacatatgccgtatggcggcaatcaagcctat
ttgcccaggtggtccgtcgggtggtacagaaagcattttaatgtggagccctcctctcca
aaacagcgcgtatacatacaattcgatggcattcacagtaatagtgaggtttggctcaat
gggcattttgtgggcaagcggccctatggatatgttagctttcagtatgatttgactcca
tatattcggtgggatgaggagaacgtaattgccgtcaaagtgggcaatacgcttcttcca
cctgacagatggtattcaggggccggtatttatcgtaatgtctggctgatttatacggat
tatcttcacataaccgaatggggcacttatattaccacacctgaaatttcaccagatgaa
gccaaggtgagtgccagaatccaggtaagtaatcattatgcgcatgctgtagagtgtacg
attatgactgaaatattggattcacagggacaactaaaagggaaaattgaaaaccgagta
acccttgcaggcttagaatcagaggaaattgagcagaaaacacgagttttagagccggaa
ttatggtcaccggaccatccagtgctctatgaagcccaaacgacgatctattgcgacaat
actgaggtggatcgttatcgtaccccttttggtataagaaaagtgatcctcgattctcaa
aaaggattattgttgaatggaagcagcttgaagctgaagggagtgtgcattcaccatgat
ttaggctgcctgggagctgcttatcatgatacagcaatgaagagaaggctggagaagctg
aaggaaatgggctgtaactcaatccgttttgctcataatcctatggcgcccgaactatta
gacttatgtgatcagatgggttttttggtggttgatgaggcttttgataaatggaaatct
ctttcctatgaacatctatatgatgaatggtgggaaaaggatctggagaccatgcttgtt
agagacaggaatcatcctagtgttttgatgtggagcgttggtaatgaagtggagaatcaa
ggtcaaccgtccatgctaaacatgctggagaaactcgttgccttttgccataaaaaagac
ccaacccggcctgttacctgtgcgcttgagccgcataatacaccgatcagcctgcgtgat
ggttcgattgaatccaaggtggagcataccaagctgctggcacaacgagtggatgtgcta
gggctgaactatcaggaacagtggtatgagcactatagagcagccatgccggatacgctt
atcctcggaacagagacattcccatactatcggggtaaagataaccgggttaaaggttat
ttacccctgaatccctggtttgatgttgctaatcatgattatgtgatcggtcaatttgtt
tggagtggaatagactatttgggagaaacaagctacccctctaaaggatggtcctccgga
ctgatcgacacatgtgggttccgcaaacctgtatcttatctccaacaaagtctatggtct
gatcagccagttgtgcacatagccgtatttaacgatcatatgaaatcggaatataatccc
acatggacaatgcactggaaatcgccgactatggaagatcactggacatttcctgaatac
gcaggaaaactgatagggttggttacctttaccaattgtgagagcgtagaattgatcgtg
aacgaggaatcatacggtgagagaaagttgaccgatttccctaatcatttaatcctatgg
gaacttccctatacgccaggaaaaattcgggctataggccgtaatgggaatcagcaggtt
tgtgagcatgaactgaccaccgctgggcttccttatgcactaaaattggaggctaatcgg
gcgattctccctgctgatgggcatgaaatatctcatgtggaagtaaccgttatagatcaa
catgggattgttgtacccaaccaggatgttgatttgagctttgaactgcatggtgatggt
cgtatccttggaatagacaatggagatctcaccagtgatgaaccctacaaggggaaagag
agacgaacacacagaggaagatgtcttgtgattgtacaatccggggatgtggctggtgag
ctgttgcttcaagcctcagcggatggggagttacagggagaagtcagtctgaaagtggaa
taa

DBGET integrated database retrieval system