KEGG   Paenibacillus polymyxa SC2: PPSC2_c0710Help
Entry
PPSC2_c0710       CDS       T01335                                 

Definition
glycosyl hydrolase family 42
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Galactose metabolism
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PPSC2_c0710
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.23  beta-galactosidase
     PPSC2_c0710
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
808818..810824
Genome map
AA seq 668 aa AA seqDB search
MKKLLYGVAYYDEYMPYDRLDQDIQMMKDAGINVVRIAESTWSTHEPQNGVFDFTSVDRV
LDAMHKAGIEVIVGTPTYAVPTWLVKEHPDVLATTPQGPGKYGARQIMDITNPVYLFHAE
RIIRKLIGRVSQHPAVIGFQTDNETKHYHTSGPNVQLQFVKYLRERFESLEELNRKFGLD
YWSNRINSWEDFPSVVGTINGSLGAAFSQFQRKLVTDFLAWQVAIVNEYKREDQFVTQNF
DFEWRGHSFGVQPDVDHFAASEAFDVTGVDIYHPSQDDLTGIEISFGGDVARSTKHNNYL
VLETEAQAFTHWVPYPGQLRLQAFSHLASGANMVAYWHWHSIHNSFETYWKGLLSHDFEP
NPVYEEAQTIGKDFARLSTHLVNLKKKNKTAILVSNEALTSINWFKFNMNSPLNYNDIVR
RLYDELYKLNIGTDIVHPGTESFDDYDLLIVPSLYSAPDALLEKLNRYVEQGGHVVYTSR
SGFTDEHVQVRTSQQPGVISEACGIHYSLFVEPKNVTLKDNPFKVAEDDNQVDTWMELIT
PTTAEVLAYYDHPHWGKYAAITQNRYGQGTATYIGCIVSSAVIRELFSSVAKKAGVWGLD
QEASYPIIVKSGTNDLGRTIRYYFNYSEQAGSVVYPHGDGKELIGEQSVTHGQLLQLKPW
SVIIIEEA
NT seq 2007 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaagctattgtacggtgttgcttattatgatgaatatatgccttatgaccgtttg
gaccaagatatccaaatgatgaaggatgcaggaatcaatgtagtgcggatagccgaatct
acttggagtacgcatgaaccgcagaacggagtgtttgatttcacctccgtggatcgggtg
ctggacgccatgcataaggcgggtattgaggtcattgtgggcacgccgacctatgccgta
cccacatggctggtgaaggagcatcccgatgtcttggcgacaacacctcagggaccgggc
aaatacggggctcgtcagattatggacattacgaacccggtgtatctgttccatgctgag
cgaatcatacgcaagctgattggacgggtaagccagcatccggcagttattggctttcag
acagacaacgagacgaagcattaccatacgagtggtcccaatgtgcaattacagtttgtg
aagtatttgcgggagcggtttgaatcactggaggagctgaaccgcaaatttggactggat
tactggagcaatcgcatcaatagctgggaggacttcccttcggtggtcggaacgattaat
ggaagcttgggcgcggccttttcccagttccagcgcaagctggtgacggacttcctggcc
tggcaggtcgcgattgtcaatgaatataagcgggaagaccaatttgttacacaaaatttt
gattttgagtggagaggtcattcctttggagttcagccggacgtggatcactttgctgca
tctgaagcgtttgatgtgacgggtgtcgatatttaccatccatcacaagatgatttgact
ggaattgaaatctctttcggtggtgatgtggcacgttcgacaaaacataataattactta
gtgctggaaacggaggcgcaggcgtttacacactgggttccttatccgggacaattgcgt
ctgcaagcgttcagtcatctggcttccggggccaatatggtagcttactggcactggcat
tccattcataattccttcgaaacctactggaagggtctgcttagccatgattttgaaccg
aatcctgtgtatgaggaagcacagacgatagggaaggactttgcaagactgtccacgcat
ctggtcaatctgaaaaagaaaaataaaacagctatcctggttagcaacgaagcgttgaca
tccattaactggtttaagtttaatatgaacagcccactgaattacaatgacatcgtacgc
cgtctgtatgacgagctgtataagctgaatattgggacagatatcgtccatccgggtaca
gaatcgtttgatgactatgatctcttgatcgttccgagtctgtattctgcgccagatgca
ctgctggaaaagctgaaccgatatgtcgaacaaggtggtcatgtggtatacacgtcccgc
agcggatttaccgacgaacatgtgcaggtgagaacatcgcagcagccgggcgtgattagc
gaagcgtgtggtattcattacagcttgtttgtggagccgaaaaatgtgacactcaaggat
aatccttttaaagtggcagaagatgacaatcaggtagatacgtggatggagctgataacg
ccgacgactgccgaagtattagcctattacgatcacccgcattggggcaaatatgctgcg
attacgcaaaatcgctatggtcagggaacggcgacctacatcggctgtatcgtcagttcg
gcggtcatccgcgaattgttcagctctgtagccaaaaaggcaggcgtatggggactggat
caggaagcttcttatccgatcattgttaagtccggtacgaatgatttgggacgaacgatc
cggtactattttaactattccgaacaagcaggctcggtggtgtatccgcacggggacggc
aaggagctgatcggagagcagtcggttacccatggacaattgctccaattgaagccttgg
agtgttataattatcgaagaagcgtaa

DBGET integrated database retrieval system