KEGG   Paenibacillus polymyxa SC2: PPSC2_c0942Help
Entry
PPSC2_c0942       CDS       T01335                                 

Definition
deoxyguanosine kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Purine metabolism [PATH:ppm00230]
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ppm00240]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1031098..1031739
Genome map
AA seq 213 aa AA seqDB search
MNNYNIPANALITVAGTVGVGKSTLTGALASRLGFKTSLEQVDHNPYLEKFYHDFERWSF
HLQIYFLAERFKEQKNIFLSGGGFVQDRSIYEDTGIFAKMHADQGTMNPTDYQTYTSLFE
AMVMTPFFPHPDVLIYLEGSLTSILSRIEERGREMEIQTERSYWEQMHRRYSDWINDFDA
CPVLRLNIDEYDVHDPASMDAILAEVGKVISKK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
gtgaataattacaacattcctgcaaatgccctgattacggtagcgggtacggtgggtgta
ggtaaatccacgttaacaggtgctttggccagtcgtcttggttttaaaacctcgttagag
caagtcgatcataatccgtatctggagaagttttatcacgattttgaaagatggagcttt
catctgcagatctattttctcgcggaacgctttaaggagcaaaagaacattttcttgtct
ggtggaggttttgtgcaggatcgttccatttatgaggacacaggcatttttgcgaaaatg
catgccgatcagggaacaatgaaccctaccgattatcaaacatatactagcctatttgag
gcgatggtcatgaccccgttctttccacaccctgatgtgctgatctatctggaaggcagc
ctgacctccatactgagtcggatcgaagaacgcggccgcgaaatggagattcagaccgag
cgatcctactgggagcaaatgcatcgcagatattccgattggatcaacgattttgatgcc
tgtcctgtactgcgtctcaacattgatgagtacgatgtacacgaccctgcttccatggat
gccattttggcagaagtgggcaaggtgatctccaaaaagtag

DBGET integrated database retrieval system