KEGG   Paenibacillus polymyxa SC2: PPSC2_c0942Help
Entry
PPSC2_c0942       CDS       T01335                                 

Definition
deoxyguanosine kinase
Orthology
K15519  
deoxyadenosine/deoxycytidine kinase [EC:2.7.1.76 2.7.1.74]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Purine metabolism
Pyrimidine metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PPSC2_c0942
   00240 Pyrimidine metabolism
    PPSC2_c0942
Enzymes [BR:ppm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.74  deoxycytidine kinase
     PPSC2_c0942
    2.7.1.76  2'-deoxyadenosine kinase
     PPSC2_c0942
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1031098..1031739
Genome map
AA seq 213 aa AA seqDB search
MNNYNIPANALITVAGTVGVGKSTLTGALASRLGFKTSLEQVDHNPYLEKFYHDFERWSF
HLQIYFLAERFKEQKNIFLSGGGFVQDRSIYEDTGIFAKMHADQGTMNPTDYQTYTSLFE
AMVMTPFFPHPDVLIYLEGSLTSILSRIEERGREMEIQTERSYWEQMHRRYSDWINDFDA
CPVLRLNIDEYDVHDPASMDAILAEVGKVISKK
NT seq 642 nt NT seq  +upstreamnt  +downstreamnt
gtgaataattacaacattcctgcaaatgccctgattacggtagcgggtacggtgggtgta
ggtaaatccacgttaacaggtgctttggccagtcgtcttggttttaaaacctcgttagag
caagtcgatcataatccgtatctggagaagttttatcacgattttgaaagatggagcttt
catctgcagatctattttctcgcggaacgctttaaggagcaaaagaacattttcttgtct
ggtggaggttttgtgcaggatcgttccatttatgaggacacaggcatttttgcgaaaatg
catgccgatcagggaacaatgaaccctaccgattatcaaacatatactagcctatttgag
gcgatggtcatgaccccgttctttccacaccctgatgtgctgatctatctggaaggcagc
ctgacctccatactgagtcggatcgaagaacgcggccgcgaaatggagattcagaccgag
cgatcctactgggagcaaatgcatcgcagatattccgattggatcaacgattttgatgcc
tgtcctgtactgcgtctcaacattgatgagtacgatgtacacgaccctgcttccatggat
gccattttggcagaagtgggcaaggtgatctccaaaaagtag

DBGET integrated database retrieval system