KEGG   Paenibacillus polymyxa SC2: PPSC2_c0977Help
Entry
PPSC2_c0977       CDS       T01335                                 

Definition
glycoside hydrolase family protein
Orthology
K01201  
glucosylceramidase [EC:3.2.1.45]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Other glycan degradation
Sphingolipid metabolism
Metabolic pathways
Class
Metabolism; Lipid metabolism; Sphingolipid metabolism [PATH:ppm00600]
Metabolism; Glycan biosynthesis and metabolism; Other glycan degradation [PATH:ppm00511]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1076173..1077690
Genome map
AA seq 505 aa AA seqDB search
MKKLPKQRRSDFFLLIVAAIILIGAILISLAMQNGVNTAGERNVSMWLTTPDPANRLTQQ
APIPWRKDNSNEVAANADTLTVEIRPDIRYQTMEGFGAAVSGSSAYLMNHGMSANQRDQL
LNDLFTAGGIQLSYIRHTIGASDYSVDEQGQPSNYTYDDVATGKDYELNHFSIAKDRDVI
DVLKQILRRNQDLWIMGTPWTAPPWMKYGEQIYNGWYLDYTDPRVYQAYADYFVRYIQAY
ANEGIPIQAISIQNEPEFTTSKYPSMSMGAVEQAKFIKQYLGPALSRNDLSTHIIAFDHN
WDTGSEYAKTVLGDEQARSYTHGTAFHCYKGEPTAMSDVHNAFPDKPVYMTECSGGAWSP
GFGDDLSWDMSKLIIGAPRNWSQNVLFWNIALDPSGGPTNGGCTNCRGVVTIDPLSGAVT
KNVEYYAIGHASKFVRPGAVRINSSHYSGSIETVAYRNPDGTLILIAANTGENTKTFKVR
QGNQVFKSTLPSKSAATFQWKPTTS
NT seq 1518 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaactcccaaaacaacgacgttctgacttcttcctgcttatagttgcagctatc
atcttgattggtgctattctgatcagtctagctatgcagaatggtgtgaacacggcaggc
gaaaggaatgtcagtatgtggctaaccacaccagacccggcgaatcgtctgacacagcaa
gccccaatcccatggagaaaagacaacagtaacgaagttgcagcgaatgcggatacactg
acggttgagattagaccagatattcgttaccagacgatggaagggtttggcgcagcagtt
tccggttcgtccgcatatctgatgaatcatggcatgtctgccaatcagcgtgatcagttg
ctcaatgacttgtttacagccggcggtattcaattaagctatattcgccataccattgga
gcatcagattattcagtggacgaacagggacagcctagcaactatacctacgatgatgtg
gcaacaggcaaggactatgagctaaatcatttttccattgccaaggatcgggatgtgatc
gatgtgctgaagcaaattctgagaagaaaccaggatttatggattatggggactccatgg
acggccccgccctggatgaaatatggtgagcagatatataacggttggtatttggactat
accgatccgcgtgtctatcaggcgtatgctgactattttgttcgttatatacaggcctat
gcgaatgaggggattcccattcaggcgatttccattcaaaatgagccggaattcaccacg
tccaagtatcccagcatgagtatgggagcagtagagcaggcgaaatttattaagcaatat
ttaggccctgctttaagtcgaaacgatttgtctacccatattattgcctttgaccataac
tgggatactgggagtgaatatgccaagaccgtactgggagacgaacaggctcgaagctat
acgcacggaacggcctttcattgctacaaaggagagccgacagcgatgtcagacgtgcac
aatgcttttccggataagcctgtttatatgacagaatgcagcggaggagcatggagtccg
ggctttggagatgatttaagctgggatatgtccaagctgattattggcgcaccccgaaac
tggtcgcaaaatgtcctcttttggaatattgcacttgacccgtccggcggtccgaccaat
ggtggatgtaccaactgtagaggtgtagtgaccatcgacccgttaagcggtgccgttacg
aaaaatgtagaatattatgcgattggacatgccagcaaatttgtccgtcctggtgcggta
cgtattaattcttctcattatagtggaagtattgaaacggtcgcttatcgtaaccccgat
ggtacgctgatcctgattgccgccaatacgggagagaacacaaagacatttaaggttcgg
caggggaatcaagttttcaaatcaacccttccatctaagtcagcagctacctttcaatgg
aagcctacaacttcctga

DBGET integrated database retrieval system