KEGG   Paenibacillus polymyxa SC2: PPSC2_c1042Help
Entry
PPSC2_c1042       CDS       T01335                                 

Definition
glycoside hydrolase
Orthology
K07406  
alpha-galactosidase [EC:3.2.1.22]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PPSC2_c1042
  Lipid metabolism
   00561 Glycerolipid metabolism
    PPSC2_c1042
   00600 Sphingolipid metabolism
    PPSC2_c1042
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PPSC2_c1042
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1175040..1176398
Genome map
AA seq 452 aa AA seqDB search
MGILAFEVHSCEQNVNGGQSMSKITFLGAGSTVFAKNVLGDCMLTPALQGFELALFDIDP
VRLKDSENILSNLKKTTGSTCVIRSYTDRKEALRGAAYVVNAIQVGGYDPCTITDFEIPK
KYGLRQTIADTVGIGGIFRNLRTIPVMLDFAADMREVCPDALFLNYTNPMAVLTNVMNVH
GGVRTVGLCHSVQACIPELFKSLGLEREGVKAKIAGINHMAWLLKVSKDGVDLYPEIKKR
AAARQREKHHDMVRFEMMLKFGYYITESSEHNAEYHPYFIKRAYPELIERFNIPLDEYPR
RCVSQIERWETMREELLGDQDLRHERSNEYASYIFEAIETNQPFAIGGNVMNTGLITNLP
KEACVEVPCLVNRNGVTPTFVGDLPPQCAALNRTNINTQLLTIEAAMTGKKEHIYHAAML
DPHTSAELSMDDIVSLCDDLIAAHGTWLPAYV
NT seq 1359 nt NT seq  +upstreamnt  +downstreamnt
atgggtatccttgcatttgaggtgcacagctgcgaacaaaatgtgaatgggggacaaagt
atgagcaagattacatttttgggtgcaggcagtacggtgtttgctaaaaatgtgcttggc
gattgtatgttgacacctgctttgcagggttttgaactggcgttgttcgatattgaccct
gttaggctgaaggattcggaaaatattttatccaatttgaaaaaaacaacggggagtacc
tgtgtgatccgctcctacactgaccgcaaggaagcactgcgtggagcggcctatgtagta
aatgccatccaggtgggcggttatgatccgtgtacgattacagattttgagattcccaaa
aaatacggactgcgccaaacgattgctgatacggttggtattggcggtattttccgcaat
ttaagaacgattccggtgatgctcgattttgcggcagacatgcgcgaggtgtgcccggat
gcactgtttctcaactataccaatccgatggctgtgttgacgaacgtgatgaacgtacac
ggtggtgtccgtacagtagggctgtgtcatagcgtacaggcgtgtatacccgagttgttc
aaaagcctcggcttggagcgggaaggtgtaaaggcaaagatcgcaggcatcaatcatatg
gcgtggctgctcaaagtgagcaaggatggggtggatttgtatcctgagattaaaaaacgg
gctgccgccaggcagcgggaaaagcatcatgatatggtacgctttgaaatgatgctgaaa
ttcggctattacattacggaatcgtccgagcataacgcagagtatcatccgtattttatc
aaacgggcatatcctgagctaattgaacgcttcaatattcctttggatgaatacccgcgc
cgctgcgtgagccagattgaacgctgggagacaatgcgtgaggaacttttgggcgatcag
gatctgcgccatgaacggtcgaatgaatatgcttcttatatatttgaggcaatcgaaacc
aatcagccctttgccattggcgggaatgtgatgaatacaggtttgattaccaatctgccg
aaggaagcctgtgtagaggtaccttgtctagtcaatcgtaatggggttacaccgaccttt
gtcggggatttgccgcctcaatgtgctgcactgaaccggacgaatattaatacccagctg
ttaacgattgaagctgcaatgacgggaaaaaaagaacacatttaccacgccgctatgctg
gacccgcacacctcggctgaattatccatggatgatatcgtttctctgtgcgacgacctg
attgcagcgcacgggacgtggcttccagcttatgtgtaa

DBGET integrated database retrieval system