KEGG   Paenibacillus polymyxa SC2: PPSC2_c1202Help
Entry
PPSC2_c1202       CDS       T01335                                 

Definition
UTP-glucose-1-phosphate uridylyltransferase
Orthology
K00963  
UTP--glucose-1-phosphate uridylyltransferase [EC:2.7.7.9]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Pentose and glucuronate interconversions
Galactose metabolism
Starch and sucrose metabolism
Amino sugar and nucleotide sugar metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Module
Nucleotide sugar biosynthesis, prokaryotes
Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PPSC2_c1202
   00052 Galactose metabolism
    PPSC2_c1202
   00500 Starch and sucrose metabolism
    PPSC2_c1202
   00520 Amino sugar and nucleotide sugar metabolism
    PPSC2_c1202
Enzymes [BR:ppm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.9  UTP---glucose-1-phosphate uridylyltransferase
     PPSC2_c1202
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1343119..1344012
Genome map
AA seq 297 aa AA seqDB search
MMKKVKKAIIPAAGLGTRFLPATKAMPKEMLPIINKPTIQYIVEEAIASGIEDIIIVTGK
GKRAIEDHFDNAFELESKLLEDGKLKLLEEVQRSSGVEIHYIRQKEPKGLGHAVWCARRF
IGDEPFGVLLGDDIVTGQKPCLRQLMDQYEETQNSVIGVQRVPQEFTNRYGIIEPDQQDG
RLYRVNNFIEKPAPGTAPSDLAIMGRYVFSPKIFKYLDLQEKGAGGEIQLTDAIQKLNQS
ERVYAYDFEGTRYDVGERLGYILTTLEFALASDDLKYPVMEAMNEWLKKTEKATTVG
NT seq 894 nt NT seq  +upstreamnt  +downstreamnt
atgatgaaaaaagtgaaaaaggccattattccagcagcaggattgggaacgcgcttcctc
cctgctaccaaagcaatgcctaaggaaatgcttccgattatcaataagcctacgattcaa
tatatcgtggaagaagcgattgcttctggtatcgaggacattattatcgttacgggtaaa
ggtaaacgtgccattgaggaccactttgacaacgcatttgagttggaatcaaagctgctc
gaggacggtaagctgaagcttctggaggaagtacagcgttcttcgggagtggaaatccat
tacattcgccagaaagaaccgaaaggtctgggacatgcggtgtggtgcgcaagacgcttt
atcggggacgagccatttggtgtgctgttgggcgacgatatcgtaacaggtcaaaaacct
tgtctgcgccagctgatggatcaatatgaggaaacacaaaattctgtgatcggcgtgcag
cgggtaccacaggaattcacgaaccggtatggcatcattgaaccggaccaacaggacgga
cgattgtaccgagtgaataattttattgaaaaaccggctccaggcacagccccatccgat
ctggctattatgggtcgttatgtgttctcaccgaaaattttcaaatatcttgatcttcag
gaaaaaggagctggcggcgaaattcagttgacggatgcgatccaaaagctgaatcagagt
gaacgcgtatacgcctatgactttgaaggcacgcgttatgacgtaggtgaacgtcttgga
tatattttaaccactcttgaatttgcacttgccagcgatgatttgaagtatccggttatg
gaggccatgaatgaatggctgaaaaagaccgagaaagcaaccacagtgggttga

DBGET integrated database retrieval system