KEGG   Paenibacillus polymyxa SC2: PPSC2_c1408Help
Entry
PPSC2_c1408       CDS       T01335                                 

Definition
alkaline phosphatase
Orthology
K01077  
alkaline phosphatase [EC:3.1.3.1]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Aminobenzoate degradation
Folate biosynthesis
Metabolic pathways
Microbial metabolism in diverse environments
Two-component system
Module
Tetrahydrofolate biosynthesis, GTP => THF
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Metabolism of cofactors and vitamins
   00790 Folate biosynthesis
    PPSC2_c1408
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PPSC2_c1408
 Environmental Information Processing
  Signal transduction
   02020 Two-component system
    PPSC2_c1408
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.3  Phosphoric-monoester hydrolases
    3.1.3.1  alkaline phosphatase
     PPSC2_c1408
Exosome [BR:ppm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPSC2_c1408
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1553357..1554667
Genome map
AA seq 436 aa AA seqDB search
MKKPSMKKSILALSAVTVLTVPLLSADIPTAFAAATSTKSTVAESKAQKAVSAKADTPKN
VILFIGDGMGEASRNAIRLATVGKSGLLEMDKMPITGLVSTSSGDNLVTDSAAAATAIAT
GVKTYNGAIGMDLNKKPVTTIMELAKKAGMSTGVVTTSQVTDATGAAFGAHVEKRSAQSE
IAKQYLEKSKLDVILGGGEDFWYPAGTPGKHPDAPAEDPEEASKGTQGNLVEQAKKLGYS
YVTDQAEMKAAKGSKLLGLFANEEMFQAHNKLGNSYNPTVSLPDMTAKAIDVLSKNKKGF
FLMVEEEGTDEMAHDNEGELTIKAGQQLDKAVKVAKDYAKAHPDTLVLVTADHETGGLAI
EGEDAEDESGEGVSKEDGPFTVKGSDEKFYIDWTTGGHTSVDVALTAMGPGSSQFSGNYP
NTAIHDKLVKLLQLKK
NT seq 1311 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaaagccttccatgaaaaagagtatccttgcgttaagtgctgtgactgttttgact
gtacccttattatctgctgatatccctacagcttttgcagccgcgacttctacgaagtcc
actgttgcagagtccaaggcacagaaggctgtatcagctaaagcggatactcctaaaaac
gtcattctttttatcggtgatggtatgggggaagccagtcgcaacgcgattcgcttagca
acggttggaaaatcgggattgcttgaaatggacaagatgcctataacgggtctggttagc
acgagttcaggggacaacctagttacagactctgccgctgctgcgactgccattgcaaca
ggtgtgaaaacgtataacggcgcgatcggaatggatttgaataaaaaaccagtgacaacc
attatggagctggctaaaaaagcaggcatgtctacaggagtggtgacgacaagccaagtg
acagatgcgacgggcgctgcctttggtgcgcatgttgagaagcgctccgcgcaaagcgag
attgccaagcagtatcttgagaaaagcaagctggatgtgattctgggcgggggtgaggat
ttctggtaccctgcaggaacaccaggcaaacatccagatgcaccggcagaagatcctgag
gaagctagtaagggaactcaaggaaatttggtggaacaagcgaagaagttgggctatagc
tatgtgacagatcaggctgaaatgaaagcagccaaaggctctaaactgctaggtctattc
gccaatgaagaaatgttccaagctcacaacaaactaggcaattcttacaacccaacggtt
tctttaccggatatgacagcgaaagcgattgatgttctatccaaaaacaaaaaaggcttt
ttcctgatggtagaggaagaaggaactgatgagatggcgcatgacaatgaaggtgaatta
accattaaagccgggcagcagctggataaggctgtcaaagtagctaaggactatgccaaa
gcgcatccagatactttggtgttagtgacggcagaccatgaaacaggcggtttggccatt
gaaggcgaagatgcggaagatgaatccggtgaaggtgtctccaaagaggacggccctttt
accgtaaaaggttctgatgagaagttttatatcgactggaccacaggaggacatacatcc
gttgatgtagcgctaactgcaatgggtccgggttcctcccaatttagtggaaattacccg
aatacggctattcatgacaagctggttaagctgcttcaattaaaaaaatag

DBGET integrated database retrieval system