KEGG   Paenibacillus polymyxa SC2: PPSC2_c1450Help
Entry
PPSC2_c1450       CDS       T01335                                 

Definition
2-oxoglutarate dehydrogenase, e2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Module
Citrate cycle (TCA cycle, Krebs cycle)
Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPSC2_c1450
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPSC2_c1450
  Amino acid metabolism
   00310 Lysine degradation
    PPSC2_c1450
Enzymes [BR:ppm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PPSC2_c1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1588980..1590275
Genome map
AA seq 431 aa AA seqDB search
MSDIIVPAMGESITEGTISKWLVKEGDSVGQGDVLLELETDKVNLEISAEEAGVVQKILR
QEGDTVVIGEAVGLIGNDSGAEATGAGEAAATQAPEAPSVATSQTSVESGGKAVEKSAPP
IPSNSDGNGQTASPSARKLARERGIDLEQVQGKDPLGRVFQEDVKTHNSAEVSRTASVPA
SPAAGKSVSPSPAQTEYSKPVERQRMSRRRATIAKRLVEAQQTAAMLTTFNEVDMTAILD
VRKRRKDKFKEKHDVGLGFMSFFTKAVVGALKRFPTVNAEINGDDIVLKKYYDIGIAVSA
KEGLVVPVVRDADRLGFAEIEKSIADLASKARSNSLSLGDLQGGTFTITNGGIFGSLLST
PILNTPQVGILGMHKIQLRPIAIDEERMENRPMMYIALSYDHRIIDGSEAVRFLVTVKEL
LEDPESLLLEG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgatattatagtgccagcaatgggagaatccatcacggaaggaacaatctccaaa
tggcttgtaaaggaaggagattccgtaggacagggagatgttctactggagctggaaacg
gataaggtcaatctggaaattagcgccgaagaagcaggtgtagtccagaaaatccttcgt
caagagggggatactgtggttatcggtgaagctgttggcttgatcggaaacgacagtggt
gcggaagcaactggtgccggagaagccgcagcgactcaagcgcctgaagcgccgtccgta
gcaacttcacagacttccgtagaaagcggcggtaaagcagtagaaaagtctgcgccgccc
atcccctccaatagtgacgggaatggtcagacggcatcaccatccgcccggaagctggcg
cgtgagcgcgggattgaccttgagcaggtacaaggaaaggacccgcttggacgtgtgttt
caggaggacgtaaaaacgcataacagcgctgaagtatcacgtacagcatctgtacctgcg
tctcccgctgctggcaagtctgtgtcaccgtctccagctcaaacagagtacagcaagcct
gtggaacggcagcggatgtcccgtcggagagcgacgattgccaagcgtcttgttgaagca
cagcaaacagccgccatgcttacgacttttaatgaagtggatatgaccgctattcttgat
gtgcgcaaacgccgtaaagataagtttaaggagaaacatgatgtagggctgggttttatg
tccttctttacgaaggcagtggttggcgcgctcaagcgcttccctactgtgaatgcagaa
atcaatggcgatgatatcgtactgaaaaaatactatgatatcgggattgctgtatctgcc
aaggaaggtttggtcgttcctgttgttagggatgctgatcggcttggttttgctgaaatt
gagaagagcattgccgatttggctagcaaagctcgttccaattcactttctctgggagac
ttgcaaggaggaacctttaccataaccaatggaggtattttcggttccctgctgtctacg
ccaattctgaatacgccgcaagtgggtattttgggaatgcataaaatccaacttcgcccg
attgccatcgacgaggaacgtatggaaaatcgtccgatgatgtatatcgcgttgtcctat
gaccaccgtattattgatggtagcgaggcggtccgtttcctggtaacggtcaaagaattg
ctggaagatcccgaatcattgttgctggaaggataa

DBGET integrated database retrieval system