KEGG   Paenibacillus polymyxa SC2: PPSC2_c1450Help
Entry
PPSC2_c1450       CDS       T01335                                 

Definition
2-oxoglutarate dehydrogenase, e2 subunit, dihydrolipoamide succinyltransferase
Orthology
K00658  
2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Citrate cycle (TCA cycle)
Lysine degradation
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPSC2_c1450
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    PPSC2_c1450
  Amino acid metabolism
   00310 Lysine degradation
    PPSC2_c1450
Enzymes [BR:ppm01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     PPSC2_c1450
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1588980..1590275
Genome map
AA seq 431 aa AA seqDB search
MSDIIVPAMGESITEGTISKWLVKEGDSVGQGDVLLELETDKVNLEISAEEAGVVQKILR
QEGDTVVIGEAVGLIGNDSGAEATGAGEAAATQAPEAPSVATSQTSVESGGKAVEKSAPP
IPSNSDGNGQTASPSARKLARERGIDLEQVQGKDPLGRVFQEDVKTHNSAEVSRTASVPA
SPAAGKSVSPSPAQTEYSKPVERQRMSRRRATIAKRLVEAQQTAAMLTTFNEVDMTAILD
VRKRRKDKFKEKHDVGLGFMSFFTKAVVGALKRFPTVNAEINGDDIVLKKYYDIGIAVSA
KEGLVVPVVRDADRLGFAEIEKSIADLASKARSNSLSLGDLQGGTFTITNGGIFGSLLST
PILNTPQVGILGMHKIQLRPIAIDEERMENRPMMYIALSYDHRIIDGSEAVRFLVTVKEL
LEDPESLLLEG
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
gtgagtgatattatagtgccagcaatgggagaatccatcacggaaggaacaatctccaaa
tggcttgtaaaggaaggagattccgtaggacagggagatgttctactggagctggaaacg
gataaggtcaatctggaaattagcgccgaagaagcaggtgtagtccagaaaatccttcgt
caagagggggatactgtggttatcggtgaagctgttggcttgatcggaaacgacagtggt
gcggaagcaactggtgccggagaagccgcagcgactcaagcgcctgaagcgccgtccgta
gcaacttcacagacttccgtagaaagcggcggtaaagcagtagaaaagtctgcgccgccc
atcccctccaatagtgacgggaatggtcagacggcatcaccatccgcccggaagctggcg
cgtgagcgcgggattgaccttgagcaggtacaaggaaaggacccgcttggacgtgtgttt
caggaggacgtaaaaacgcataacagcgctgaagtatcacgtacagcatctgtacctgcg
tctcccgctgctggcaagtctgtgtcaccgtctccagctcaaacagagtacagcaagcct
gtggaacggcagcggatgtcccgtcggagagcgacgattgccaagcgtcttgttgaagca
cagcaaacagccgccatgcttacgacttttaatgaagtggatatgaccgctattcttgat
gtgcgcaaacgccgtaaagataagtttaaggagaaacatgatgtagggctgggttttatg
tccttctttacgaaggcagtggttggcgcgctcaagcgcttccctactgtgaatgcagaa
atcaatggcgatgatatcgtactgaaaaaatactatgatatcgggattgctgtatctgcc
aaggaaggtttggtcgttcctgttgttagggatgctgatcggcttggttttgctgaaatt
gagaagagcattgccgatttggctagcaaagctcgttccaattcactttctctgggagac
ttgcaaggaggaacctttaccataaccaatggaggtattttcggttccctgctgtctacg
ccaattctgaatacgccgcaagtgggtattttgggaatgcataaaatccaacttcgcccg
attgccatcgacgaggaacgtatggaaaatcgtccgatgatgtatatcgcgttgtcctat
gaccaccgtattattgatggtagcgaggcggtccgtttcctggtaacggtcaaagaattg
ctggaagatcccgaatcattgttgctggaaggataa

DBGET integrated database retrieval system