KEGG   Paenibacillus polymyxa SC2: PPSC2_c1896Help
Entry
PPSC2_c1896       CDS       T01335                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Class
Metabolism; Overview; Carbon metabolism [PATH:ppm01200]
Metabolism; Overview; Biosynthesis of amino acids [PATH:ppm01230]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppm00010]
Metabolism; Carbohydrate metabolism; Pentose phosphate pathway [PATH:ppm00030]
Metabolism; Carbohydrate metabolism; Fructose and mannose metabolism [PATH:ppm00051]
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppm00052]
Metabolism; Energy metabolism; Methane metabolism [PATH:ppm00680]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1974538..1975509
Genome map
AA seq 323 aa AA seqDB search
MTAVKKIAVLTSGGDSQGMNAAVRAVVRSGLYFGLEVFGIQRGYQGLLNDDIFPMDLRSV
GDIIQRGGTVLQSARCLEFTTEEGQKRGAEILRNRGIDGVVVIGGDGSYQGANKLTKQGI
KTMCLPGTIDNDISFTDYTIGFDTAVSIVVDAINKLRDTMSSHERSSIVEVMGRHCGDIA
LHAGLASGAETILVPEVEFDLNEVSDRMKQNFKHGKRHSIIIVAEGVGKGETVAKVIQEN
CPDYEPRVTVLGHIQRGGTPTAFDRNLASRLGDFAVRQLIEGVSDKACGTIDGKLVATDI
DKVVNTKKDFNMELYELALRLSQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagttaagaaaattgcagtattaacaagtggtggagattcacaagggatgaac
gcggcagttcgcgccgttgtgcgtagcggattgtatttcggactcgaagtattcgggatc
caacgcggatatcaaggtcttttgaacgacgatatttttccaatggacctgagaagcgtc
ggagatattatccaacgtgggggtactgtacttcaatctgcaagatgcctggaatttacg
actgaagaaggccagaaacgtggcgctgaaattttgcgtaatcgtggaattgacggcgta
gtcgtaattggtggcgacggttcttaccaaggagctaacaagctgaccaagcaaggcatt
aaaaccatgtgtcttccaggaacgattgacaatgatatttccttcacagactacactatt
ggttttgatacggcggttagtattgtagtggacgcaatcaacaagctgcgtgatacgatg
tcttcccatgaacgttcttccattgtggaagttatgggacgtcattgtggcgatattgct
ctccatgcaggtctggcttccggtgcagaaacgatcttggtacctgaggtggaatttgat
ctgaatgaagtatccgatcggatgaaacaaaacttcaaacatggcaaacgccacagtatc
attatcgttgctgagggtgtaggcaaaggcgaaacagtagcaaaagtaatccaagaaaat
tgtccggattatgagcctcgtgttacagtgcttggacacattcaacgtggaggtacacca
actgcgtttgaccgtaacctcgcaagccgtttgggggactttgctgttcgtcaattgatt
gagggtgtatctgacaaagcttgcggtacgatcgacggtaagctggtagctacagatatt
gacaaggttgtaaataccaaaaaagatttcaacatggagctttatgagttggctctgcgt
ttgtcccaataa

DBGET integrated database retrieval system