KEGG   Paenibacillus polymyxa SC2: PPSC2_c1896Help
Entry
PPSC2_c1896       CDS       T01335                                 

Definition
6-phosphofructokinase
Orthology
K00850  
6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Glycolysis / Gluconeogenesis
Pentose phosphate pathway
Fructose and mannose metabolism
Galactose metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Biosynthesis of amino acids
Module
Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Formaldehyde assimilation, ribulose monophosphate pathway
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPSC2_c1896
   01230 Biosynthesis of amino acids
    PPSC2_c1896
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPSC2_c1896
   00030 Pentose phosphate pathway
    PPSC2_c1896
   00051 Fructose and mannose metabolism
    PPSC2_c1896
   00052 Galactose metabolism
    PPSC2_c1896
  Energy metabolism
   00680 Methane metabolism
    PPSC2_c1896
Enzymes [BR:ppm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     PPSC2_c1896
Protein phosphatases and associated proteins [BR:ppm01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     PPSC2_c1896
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
1974538..1975509
Genome map
AA seq 323 aa AA seqDB search
MTAVKKIAVLTSGGDSQGMNAAVRAVVRSGLYFGLEVFGIQRGYQGLLNDDIFPMDLRSV
GDIIQRGGTVLQSARCLEFTTEEGQKRGAEILRNRGIDGVVVIGGDGSYQGANKLTKQGI
KTMCLPGTIDNDISFTDYTIGFDTAVSIVVDAINKLRDTMSSHERSSIVEVMGRHCGDIA
LHAGLASGAETILVPEVEFDLNEVSDRMKQNFKHGKRHSIIIVAEGVGKGETVAKVIQEN
CPDYEPRVTVLGHIQRGGTPTAFDRNLASRLGDFAVRQLIEGVSDKACGTIDGKLVATDI
DKVVNTKKDFNMELYELALRLSQ
NT seq 972 nt NT seq  +upstreamnt  +downstreamnt
atgacagcagttaagaaaattgcagtattaacaagtggtggagattcacaagggatgaac
gcggcagttcgcgccgttgtgcgtagcggattgtatttcggactcgaagtattcgggatc
caacgcggatatcaaggtcttttgaacgacgatatttttccaatggacctgagaagcgtc
ggagatattatccaacgtgggggtactgtacttcaatctgcaagatgcctggaatttacg
actgaagaaggccagaaacgtggcgctgaaattttgcgtaatcgtggaattgacggcgta
gtcgtaattggtggcgacggttcttaccaaggagctaacaagctgaccaagcaaggcatt
aaaaccatgtgtcttccaggaacgattgacaatgatatttccttcacagactacactatt
ggttttgatacggcggttagtattgtagtggacgcaatcaacaagctgcgtgatacgatg
tcttcccatgaacgttcttccattgtggaagttatgggacgtcattgtggcgatattgct
ctccatgcaggtctggcttccggtgcagaaacgatcttggtacctgaggtggaatttgat
ctgaatgaagtatccgatcggatgaaacaaaacttcaaacatggcaaacgccacagtatc
attatcgttgctgagggtgtaggcaaaggcgaaacagtagcaaaagtaatccaagaaaat
tgtccggattatgagcctcgtgttacagtgcttggacacattcaacgtggaggtacacca
actgcgtttgaccgtaacctcgcaagccgtttgggggactttgctgttcgtcaattgatt
gagggtgtatctgacaaagcttgcggtacgatcgacggtaagctggtagctacagatatt
gacaaggttgtaaataccaaaaaagatttcaacatggagctttatgagttggctctgcgt
ttgtcccaataa

DBGET integrated database retrieval system