KEGG   Paenibacillus polymyxa SC2: PPSC2_c2031Help
Entry
PPSC2_c2031       CDS       T01335                                 

Definition
beta-d-galactosidase
Orthology
K12308  
beta-galactosidase [EC:3.2.1.23]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Galactose metabolism
Class
Metabolism; Carbohydrate metabolism; Galactose metabolism [PATH:ppm00052]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2111049..2113076)
Genome map
AA seq 675 aa AA seqDB search
MISSKLPKVFYGGDYNPEQWDEATHQEDLRMFRQAGIDIATLNVFSWAKIQSDEITYHFE
WLDQLIDNLYESDIFVCLATSTAAHPAWMATRYPDILRVDADGRKRKFGGRHNSCPNSPT
YRKYAEQMADRLAERYKDHPAILVWHVSNEYGGDCYCDNCAAAFRVWLKQKYESLEELNR
VWNTSFWGHTFYDWDEIVPPNNLSEHWGENHSTFQGISLDYARFNSDSMLDCYLLEYNAI
KKHIPDAVVTTNLMGFFKQLDYFKWAKHMDIVSWDSYPGANTPISYTAMAHDLMRGLKDG
QPFMLMEQTPSQQNWQAYNSLKRPGVMRLWSYQAVAHGADTVMFFQLRRSIGACEKFHGA
VIEHAGHENTRVFREVAQLGNELGALGNTLLDATVHAKVAILFDWDNWWALEKSSGPSVA
LKYLDQVHKYYATLFRRNVQVDLISVDTDFQKYDLIIAPVLYMVKPSTAEKLEQFTERGG
TFLTTFFSGIVNENDLVTTGGYPGKLRNLLGIWVEEIDALLPESHNRIILKEKVGVLEGE
YKCGLLCDLLHSEGAEVLAEYGDDFYQGMPVLTRNRFGQGEAWYVATDPEEPFLDGLLGY
ICEQKGISSLLRAPAGIEATMRSKDGKSYLFVLNHNAQTQQYHLDDQKGKELISGKFLEG
DICIEGYGFQVLELS
NT seq 2028 nt NT seq  +upstreamnt  +downstreamnt
atgataagcagcaaacttcctaaagtattttacggtggggattacaatcctgagcaatgg
gatgaggccacgcatcaggaggatttacggatgttcagacaggcaggaattgatatcgcc
acactcaacgttttctcatgggctaaaattcagtctgacgaaatcacatatcattttgag
tggctggatcagttgattgataatctttatgaaagcgatatcttcgtttgtctagctact
agtacggcagcgcatcctgcttggatggctacccgttatcccgacattcttcgggtcgat
gctgacgggcgtaagcgaaaattcggaggacgacataactcttgtccgaacagtccaacc
tatcgaaaatacgcagagcagatggctgaccgacttgcagagcgatacaaagaccatccc
gcaatcctcgtgtggcacgtatccaatgagtatggcggggattgctattgtgacaattgt
gccgcagcgttccgggtatggctcaaacaaaaatacgaatcactagaagagctaaaccgg
gtgtggaatacttccttctggggtcacaccttctatgattgggatgaaattgtacctcca
aataatctgagtgagcattggggagaaaatcactccacatttcagggcatatcccttgat
tatgcgcgcttcaattcagacagtatgctggattgctacctgctggaatataacgcgatt
aaaaaacatattcccgatgccgtggtaacaaccaatctgatgggcttttttaagcaactg
gattattttaagtgggctaagcacatggatatagtatcttgggacagctatcccggggct
aataccccgataagctatacggcgatggcgcacgacctgatgcgcggcttgaaggatggg
cagccctttatgctgatggagcaaacaccgagccaacagaattggcaggcgtataattca
cttaaacgacctggcgttatgcgtttatggagttatcaggctgtagcacatggcgcggat
acggtcatgtttttccagcttcgccgctcgatcggtgcttgcgagaaattccacggggcc
gtaattgagcatgccgggcatgagaacacacgtgtatttcgcgaggtggcacagcttggc
aatgagctcggcgctttaggcaacacgctgcttgacgcgactgttcatgccaaagtagct
attttgtttgattgggacaattggtgggctttggaaaagtcaagcggcccttctgtcgcc
ttgaaatacttggatcaggtgcataagtattatgctaccctcttccggcgtaacgtacag
gtagacctgatttctgtggacacagatttccaaaaatatgatctcattatcgcgcctgta
ctctacatggtcaagccgagtactgctgagaaactggaacaattcacagagcgtggcggc
accttcttaacgacctttttcagtggcattgtaaatgaaaacgatctggttacaaccgga
ggatatcctggtaaactgcgtaatttactcgggatctgggtggaggaaattgatgcgctt
ctgcctgaatcacacaaccgcattatattgaaagaaaaagtgggcgtattagaaggtgaa
tataagtgtgggttgctctgcgacttgctgcatagcgaaggagccgaggttctggcggaa
tacggcgatgatttctatcagggcatgccagtactgacacgcaatcgctttggtcaaggt
gaagcgtggtatgtcgctactgaccctgaggaacctttccttgatggtctgctgggctac
atttgtgagcaaaaagggatttcatccctgctgcgtgctcctgcgggcatagaagccact
atgcggtccaaagatggaaagtcgtatctatttgttctgaaccataatgcccagacacag
caatatcatctggatgaccaaaaaggaaaagagctgatcagcggaaaattcctggaagga
gatatttgtattgaaggctatggctttcaagtgctggagctatcctaa

DBGET integrated database retrieval system