KEGG   Paenibacillus polymyxa SC2: PPSC2_c2111Help
Entry
PPSC2_c2111       CDS       T01335                                 

Definition
protein-glutamate methylesterase
Orthology
K03412  
two-component system, chemotaxis family, response regulator CheB [EC:3.1.1.61]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Two-component system
Bacterial chemotaxis
Class
Environmental Information Processing; Signal transduction; Two-component system [PATH:ppm02020]
Cellular Processes; Cell motility; Bacterial chemotaxis [PATH:ppm02030]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2185801..2187354
Genome map
AA seq 517 aa AA seqDB search
MFNMCAYRVLVVDDSAFMRKIITDLIVRDESFNIVGTAANGREAVEKVKELQPDLVTMDV
EMPEMNGLEALPLIMAAHPLPVIMLSGINEQGMKETIMALEAGAFDFIRKPSIAHAQDIE
QVSKALLEQMHTAMQAVRSRLERKEANERKAALEQAKKTPMEKPPGQAVTEKRAGSQASA
DKPPVVPLASPPAASAQPKKDAGKSVPTAAKQETKKQLSGTAATADRIDKPAVQPRKPVQ
APHVQKKEDLSMGTGITSGQLKSSEPTAGKSMQGKDKAGLVKPESRKTVTSSASSTPAAT
TPPVTAPTVPAAPKGLSLKKGVHTSSFRKLVAVGCSTGGPRALKTLLERIPGDFPAPIVI
VQHMPPNFTRSLAQRLNTLSPLRVVEAEQGMTLETGTAYIAPGGYQLRIVPGAGGKYTVS
LKMEEARNGHRPSVDTMFESLLSLTSLERHLVLLTGMGSDGAKMMKKLYDAGVQSTFAEN
EETCVVYGMPRSAVELKCVRHLLPMQEIAPKLVQVVK
NT seq 1554 nt NT seq  +upstreamnt  +downstreamnt
gtgtttaacatgtgtgcttaccgggtgctggttgtagatgattcggcctttatgcgcaaa
attattacagatctaattgtaagggatgagtcgttcaacatcgtaggtacagccgccaat
ggcagagaggctgtagagaaagtgaaagaattgcagcctgatttggtcaccatggatgtc
gaaatgcctgaaatgaatggtcttgaagcgttgccactgattatggcagcccatccgcta
cctgtcattatgctgtcaggcatcaatgaacaaggcatgaaggagaccatcatggctttg
gaggcaggggcttttgattttataagaaagccttccattgctcatgcgcaagatattgag
caggtgagcaaggcattgctcgaacagatgcatactgctatgcaagcagtacgcagccgc
ttggagcgcaaggaagctaatgaacgcaaagctgcattggaacaagcgaaaaaaacgcca
atggaaaagccacctggacaggctgtgactgagaaacgagctggaagtcaagcttcggca
gacaagcctcctgttgttccgcttgcttctccacctgctgcatcggctcagccaaagaaa
gatgctgggaagtccgtcccaacagctgccaagcaggaaactaaaaaacagctgtctgga
acagctgctacagctgatcgcatagacaagccagctgttcagccaaggaaaccagtgcaa
gcacctcatgtgcagaagaaagaagacttgtccatgggtacgggaataacgtcgggacaa
ctgaagagctctgagccgaccgctggcaaatcgatgcagggtaaggataaagcagggttg
gtcaagccggaatcacggaagacggtaacttcatcagcttcttccactcctgcggctaca
acgcctccagtaacagcacctacagttccagccgcaccaaagggattgtcacttaaaaaa
ggtgtacacacgtccagctttcgaaaactggtggcggtcggatgttctacgggcggacca
cgggcgctgaagacgctgttggagcgcatccctggggattttccagctccaatcgttatc
gttcagcatatgccgccaaacttcactcgttcgctagcccaacggttgaatacgttgagt
ccactacgagtggtggaggctgagcaggggatgacgctggagacgggaacagcctacatc
gctccagggggatatcagctaagaattgtgcctggagccggtggtaaatacactgtgtca
ctgaagatggaggaggctcgcaatggtcaccgtccttccgtagatacgatgttcgaatca
ctgctctcgttaacctcgctggaaagacatctagtattgcttactggaatggggagcgac
ggggctaaaatgatgaaaaagctttatgacgctggggttcaatccacatttgctgaaaat
gaggagacttgtgtagtgtacggaatgccccgctcagcagttgaattaaaatgtgtgcgc
caccttctgccaatgcaggagatcgcccccaagcttgtacaagttgtgaaataa

DBGET integrated database retrieval system