KEGG   Paenibacillus polymyxa SC2: PPSC2_c2555Help
Entry
PPSC2_c2555       CDS       T01335                                 

Definition
glycoside hydrolase clan gh-d
Orthology
K07407  
alpha-galactosidase [EC:3.2.1.22]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Galactose metabolism
Glycerolipid metabolism
Sphingolipid metabolism
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    PPSC2_c2555
  Lipid metabolism
   00561 Glycerolipid metabolism
    PPSC2_c2555
   00600 Sphingolipid metabolism
    PPSC2_c2555
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.22  alpha-galactosidase
     PPSC2_c2555
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 
Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(2648641..2650914)
Genome map
AA seq 757 aa AA seqDB search
MNIHVNEALGLFHLQSKDCSYIIQLVEGYPAHVYWGAQLHHDQSLASILELRERCSFSPT
PDSSSRTLSLDTLPQEYPQYGTSDFRQPAYQVALADGTRTTELKYSGYRIEPGKPKLEGL
PSVYTESDDEATTLLLFLEDQHSGLKTTLLYTVFANHSAIARSTLFEHKGSAVMNIEHAM
SASVDFADSNYQALYLSGAWVRERHIQRRDLGPGAIRLESRRGSSSHQMNPFLALLRPDA
TEDRGDVYGFSLIYSSNFVAQAEVEQFNQTRVSIGINPFDFSWRLEPGQSFQTPEAVLVF
SEEGLGGMSRTYHRLYRTRLCRGTYRDKERPILVNNWEATYFDFDADKIEAIAKEAGPLG
IELFVLDDGWFGKRDNDNSSLGDWFEDRRKLPGGLTDLAKRVNEQGLQFGLWVEPEMVSP
DSELYRTHPDWCLHAEGRRRTEGRSQLVLDLSRKEVCDYLYETLSSVFSIAPITYVKWDM
NRNMTEIASATATSERQKEIAHRYMLGLYDLLERLTSRFPDILFESCSGGGGRFDPGMLY
YMPQTWTSDDTDAIERLAIQYGTSIVYPASTMGAHVSNVPNHQVGRNTSLAIRGDVAMSG
NFGYELDLTAFTNEEKELAARQIAQYKEIRSLVQQGDMYRLLSPFEGRGDTAWMFVSEDQ
SEAFVAYFRVLAEPNGPIRRLTLKGLDPAKKYIIETGATGNTSDPINTSTEDGVSPFRLA
FDGEIFGGDRLMKIGLVVSDLTGDFASSTFRLKAISC
NT seq 2274 nt NT seq  +upstreamnt  +downstreamnt
atgaacattcatgttaacgaggcgcttggtttgtttcacctgcagtccaaggattgcagc
tatattatccagcttgtagaaggatatcctgcacatgtctattggggagctcaacttcat
catgaccaaagtcttgcaagtatattggagcttagagaacgctgttccttctctcccact
cccgattcttccagtcgtacgctttctttggatacgcttccacaggaatatccacagtat
ggaacaagcgacttccgtcagccggcttatcaagttgcgcttgccgatggaactcggact
acagagctaaaatatagtggttaccgtattgaaccgggtaaacccaagctcgaaggactt
ccttccgtctataccgaatcagatgatgaagcaacaactctcttgttgttcctcgaggat
caacactcaggccttaagactacactgctttatactgtgtttgcgaaccacagcgccatt
gctaggtctactctttttgaacataagggaagcgctgtcatgaatattgagcatgcgatg
agcgcctctgtcgacttcgccgattccaattaccaagctctctatttatctggtgcctgg
gttcgggaaagacatatccagcgccgcgatcttgggcccggcgccattcgcttggaaagc
cgacggggctccagcagtcaccaaatgaatccttttctggcactgcttcgtcctgatgca
actgaagatcgtggggatgtgtacggcttcagtctaatttacagcagcaacttcgtcgca
caggcggaagtagagcaatttaatcagactcgtgtaagtatcggaatcaatccttttgac
ttctcctggcggcttgaaccgggtcagtcattccagactcctgaagccgtgctggtcttt
tccgaagaaggtcttggaggcatgtcgcgcacctatcaccggctctaccgcacacgtctg
tgccggggaacttatcgcgacaaggaacgcccgattctcgtgaacaattgggaagccaca
tattttgacttcgacgccgataaaattgaggcgattgccaaagaagcgggacctcttgga
attgagctatttgtccttgatgacggttggtttggcaagcgtgacaacgataacagttcg
cttggagactggttcgaagaccgccgcaagctacctggtggtcttaccgatttggccaaa
cgagttaatgaacaaggattacagtttggcttatgggttgagccggaaatggtatcacct
gatagtgaactgtaccgcacccatcccgactggtgcctgcatgcagaaggtcggcggcgg
acggaaggtcgatcccaattggtgcttgatctctcccgcaaagaagtatgcgattacttg
tacgagacgcttagctccgtattctcgatcgctccaattacttatgtcaagtgggacatg
aatcgtaatatgacggagatcgcttcggctactgctactagcgaacgccaaaaggaaatt
gcgcaccgttatatgctaggactttatgatctgctggaacgcctgacctcacggttcccg
gacatcttgtttgaaagctgttctggcggaggcggacgattcgatccagggatgctctac
tatatgccgcagacatggaccagtgatgacactgatgctattgaaagattggcgatccag
tacggcaccagcatcgtgtatccggccagtactatgggggcccacgtatcgaacgtgccg
aaccaccaggtgggacgaaacacctccctcgccatacgtggcgacgtggcaatgagcggg
aattttggctacgaacttgaccttactgcatttacaaatgaagaaaaagagctcgctgcc
agacaaattgcccagtataaagaaatccgctcccttgtacagcagggagatatgtatcga
cttcttagtccgtttgaaggccgaggcgatactgcctggatgtttgttagcgaggaccag
tccgaagcttttgtcgcttacttccgtgtgctggctgagccaaatggacctatccggcga
ctaacgctaaaaggacttgacccagccaaaaagtatataatcgaaaccggtgcgaccggc
aatacttcagatcctattaatacctcgactgaagatggcgtttcccctttccgtctagcg
tttgacggcgaaatttttggaggtgaccgcttaatgaaaattgggcttgttgtctcggat
cttactggggattttgccagctctaccttccgccttaaagcgatctcttgctaa

DBGET integrated database retrieval system