KEGG   Paenibacillus polymyxa SC2: PPSC2_c2575Help
Entry
PPSC2_c2575       CDS       T01335                                 

Definition
glycoside hydrolase families 5 and 6 domain protein
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Class
Metabolism; Carbohydrate metabolism; Starch and sucrose metabolism [PATH:ppm00500]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2672996..2674477
Genome map
AA seq 493 aa AA seqDB search
MKMSFNSFTKPLIMILLFSLLTLLFQAALPATPASAAACANPVSYFGEMKASGNKINGSK
TNRPMMVKGSSFFWSNWSGPFWNTATVNRMVDEFQVEIVRAAYGVDPSGNPYNTADESKV
RDVVNAAIAKGIYVIIDWHSHDAHNNVNAAKSFFSRMAQEYGSYDNVIFEIYNEPTQVSW
GTIKSYAEQVIPAIRQHSDNLIVVGTPFWSQNVDQAANDPITSSSNIAYTLHFYAGTHFQ
SLRDKANYAMSKGIPLFVTEMGFVNADGDGGINYDSTNQWLDWMNQNNLSWANWAINDKT
EGASIFNTNGSLTAGGNYLKSILAGHAPYAEWRQNAACGGSSANTLYDFEGSTQGWTGSN
ISDGPWSVNEWSSKGSNSLKADIIMSANSQHYLLLSQSRNLSGKATLSATVKHASWDSAG
DGLNAKIYAKTGSGWAWYAGKAVKINSSGGTTLSFNLASVPNLDDVREIGIQFLASANSS
GKSAVYVDNVTLQ
NT seq 1482 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatgtcgttcaattcattcactaagccattaatcatgatcctactgttcagttta
ttaacgctactttttcaagcggccttacctgcaacgcccgcttctgcagctgcctgcgca
aaccctgtaagttatttcggtgaaatgaaagcaagtggaaacaagattaacggctccaaa
acgaatcggcctatgatggtcaaagggtcgagcttcttctggagcaactggtccggtcca
ttttggaataccgccacggtgaatcggatggtggatgaattccaagtagagatcgtaaga
gcggcatatggcgtggaccccagcggaaatccgtataacacggccgatgaatccaaagtt
cgtgacgtggtcaatgcggcaattgctaaggggatctatgttattatcgattggcactca
catgacgcgcacaacaacgtcaacgccgctaaaagtttcttcagccgcatggcgcaggaa
tacggaagctatgataacgtcattttcgagatctataacgaacctacgcaagtctcgtgg
gggacaatcaaaagttacgctgagcaagttattccagccattcgtcaacattctgacaat
ctaattgtcgttggtacgccattctggtctcagaatgtagaccaggcagcgaacgatccc
attacatcctctagtaatatcgcctatacattgcacttttacgctggaactcattttcag
tcgctccgggacaaagccaactacgcaatgagtaagggcatcccgctatttgttaccgag
atgggctttgttaacgcggatggcgacggcggcattaattacgattccacgaaccaatgg
cttgactggatgaaccagaataacctgtcatgggccaactgggcgattaatgacaagaca
gaaggcgccagtattttcaatacgaacgggagtctcacagcaggaggtaactatctgaaa
agcattctagccgggcacgcaccgtatgccgagtggaggcagaatgcggcttgcggtggc
agtagcgcaaacacattatatgacttcgagggtagtacgcagggctggaccggttcgaat
atatccgatggtccatggagcgtaaacgagtggtcatccaagggcagtaattctcttaaa
gcggatatcatcatgtctgctaattcccagcactacctgcttctctcacaaagccgcaac
cttagtggtaaggcaacgctaagcgcgaccgtcaaacatgcatcttgggactccgcaggt
gacggactcaatgccaagatttatgccaagacaggatcaggttgggcttggtatgctggc
aaagctgtcaagataaattcttctggaggtacgacgctgtcgttcaaccttgcatctgta
cccaatcttgacgatgttagggaaatcggcatacaatttcttgcctcggcgaacagcagc
ggtaagtcagccgtttacgttgacaacgtgacacttcaataa

DBGET integrated database retrieval system