KEGG   Paenibacillus polymyxa SC2: PPSC2_c2793Help
Entry
PPSC2_c2793       CDS       T01335                                 

Definition
glutaminase 1
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Amino acid metabolism
   00250 Alanine, aspartate and glutamate metabolism
    PPSC2_c2793
   00330 Arginine and proline metabolism
    PPSC2_c2793
  Metabolism of other amino acids
   00471 D-Glutamine and D-glutamate metabolism
    PPSC2_c2793
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.1  In linear amides
    3.5.1.2  glutaminase
     PPSC2_c2793
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2968884..2969822
Genome map
AA seq 312 aa AA seqDB search
MTSEWQRLQTKLPEWVEQSRHEYIHGKVAAYIPELSKAPADALGIVVMNGAGETVVAGDT
EIQFTMQSISKVFTLILALMDNGEDVVFSKVGMEPTGDRFNSMLKLELVEPGIPFNPLIN
AGAIAVSSLIRGNSPEERFARVLQFFRLLTHNDTLEYDQDVYDSESATGHLNRSLAYFLM
EKGILRGHVEDVLDVYFRHCAVKLNCTDLARMGLILAYNGRDPVTGIPLIPRRYVQIAKT
FMTTCGMYDASGEFAIQVGLPAKSGVSGSIMTMVPGRYGIGLVGPSLNRMGNSTAGVHLL
ETMSRDLDWSLF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacatcggagtggcagagattacagaccaaactgccggaatgggtagaacaaagccgt
catgagtatattcatggcaaggtagcagcatatattcccgaactgtccaaagccccggcc
gacgcgctgggtattgtggtaatgaacggtgcgggtgagaccgtggtagccggagatacg
gaaatacaatttacgatgcagagcatctcaaaggtatttacgctcattctggccttgatg
gataatggagaggacgttgtcttctctaaggtggggatggagcctaccggggaccgtttt
aattccatgctaaagctagaactggttgagccggggataccgtttaatccactgattaac
gctggagcaattgctgtctcctctctgattcgcggaaacagtccagaagagagatttgcc
cgtgtccttcaatttttccgtctgcttactcataatgacacattggaatatgatcaggat
gtctacgattcagaatcagccacaggccatttaaaccgttcccttgcttattttctaatg
gaaaaggggattttaagaggtcatgtggaggatgtgcttgacgtctatttcagacattgt
gctgtcaaattgaactgtacagatttagcacgtatgggactcatactagcctacaacggc
cgtgatccggtcacaggtatacctctgattccccgtcgctatgtacagatcgccaaaaca
tttatgacaacatgcggtatgtatgacgcctctggtgaattcgccattcaagtcgggctc
cctgccaaaagcggcgtatctggtagtataatgacgatggtacccggacgatacggcatc
gggctagtgggtccttcattgaatcgtatgggcaacagtacagcgggggtacacttgctg
gagacaatgtcacgggatttggattggagcttgttttag

DBGET integrated database retrieval system