KEGG   Paenibacillus polymyxa SC2: PPSC2_c2793Help
Entry
PPSC2_c2793       CDS       T01335                                 

Definition
glutaminase 1
Orthology
K01425  
glutaminase [EC:3.5.1.2]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Alanine, aspartate and glutamate metabolism
Arginine and proline metabolism
D-Glutamine and D-glutamate metabolism
Metabolic pathways
Class
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ppm00250]
Metabolism; Amino acid metabolism; Arginine and proline metabolism [PATH:ppm00330]
Metabolism; Metabolism of other amino acids; D-Glutamine and D-glutamate metabolism [PATH:ppm00471]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
2968884..2969822
Genome map
AA seq 312 aa AA seqDB search
MTSEWQRLQTKLPEWVEQSRHEYIHGKVAAYIPELSKAPADALGIVVMNGAGETVVAGDT
EIQFTMQSISKVFTLILALMDNGEDVVFSKVGMEPTGDRFNSMLKLELVEPGIPFNPLIN
AGAIAVSSLIRGNSPEERFARVLQFFRLLTHNDTLEYDQDVYDSESATGHLNRSLAYFLM
EKGILRGHVEDVLDVYFRHCAVKLNCTDLARMGLILAYNGRDPVTGIPLIPRRYVQIAKT
FMTTCGMYDASGEFAIQVGLPAKSGVSGSIMTMVPGRYGIGLVGPSLNRMGNSTAGVHLL
ETMSRDLDWSLF
NT seq 939 nt NT seq  +upstreamnt  +downstreamnt
atgacatcggagtggcagagattacagaccaaactgccggaatgggtagaacaaagccgt
catgagtatattcatggcaaggtagcagcatatattcccgaactgtccaaagccccggcc
gacgcgctgggtattgtggtaatgaacggtgcgggtgagaccgtggtagccggagatacg
gaaatacaatttacgatgcagagcatctcaaaggtatttacgctcattctggccttgatg
gataatggagaggacgttgtcttctctaaggtggggatggagcctaccggggaccgtttt
aattccatgctaaagctagaactggttgagccggggataccgtttaatccactgattaac
gctggagcaattgctgtctcctctctgattcgcggaaacagtccagaagagagatttgcc
cgtgtccttcaatttttccgtctgcttactcataatgacacattggaatatgatcaggat
gtctacgattcagaatcagccacaggccatttaaaccgttcccttgcttattttctaatg
gaaaaggggattttaagaggtcatgtggaggatgtgcttgacgtctatttcagacattgt
gctgtcaaattgaactgtacagatttagcacgtatgggactcatactagcctacaacggc
cgtgatccggtcacaggtatacctctgattccccgtcgctatgtacagatcgccaaaaca
tttatgacaacatgcggtatgtatgacgcctctggtgaattcgccattcaagtcgggctc
cctgccaaaagcggcgtatctggtagtataatgacgatggtacccggacgatacggcatc
gggctagtgggtccttcattgaatcgtatgggcaacagtacagcgggggtacacttgctg
gagacaatgtcacgggatttggattggagcttgttttag

DBGET integrated database retrieval system