KEGG   Paenibacillus polymyxa SC2: PPSC2_c2872Help
Entry
PPSC2_c2872       CDS       T01335                                 

Definition
1,4-alpha-glucan-branching protein
Orthology
K00700  
1,4-alpha-glucan branching enzyme [EC:2.4.1.18]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PPSC2_c2872
Enzymes [BR:ppm01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.18  1,4-alpha-glucan branching enzyme
     PPSC2_c2872
Exosome [BR:ppm04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   PPSC2_c2872
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3049958..3051883)
Genome map
AA seq 641 aa AA seqDB search
MTDQTLPQQTISSEDIYLFHEGTLYHSYRSLGSHLTVENGEQGVRFTVWAPHALHVGLAT
DRNNWNGEQDSLYRVPKSGFWSRFFPRISQGTFYKYDITGPNGERFLKADPYAVRAEVRP
ATASVVSSLDGYVWNDAAWRRKRRAPYGKPLHIYELHLGTWKQKADGTFYTYREMAELLV
PYVTDMGYTHIELMPLSEHPYDLSWGYQLTGYFALTSRYGEPHDFMYLVDRCHQAGIGVI
MDWVPAHFAKDAHGLRRFDGSPLFEYADPLIAEKPGWGTLTFDYSKPEVRSFLISNALFW
MDVYHIDGLRVDAVTSMLRLDFEKQEGQYCLNSKGGIENEEAIAFLQQLNETVFRYYPYA
LMMAEESSAWPMVTSPVSDGGLGFNYKWNMGWMNDTLDYMESEFDQRPERHNLLTFPIAY
AYSENFTLPLSHDEVVHGKKSLLDKMPGTYEQKFAGLRALLGYQMTSPGKKLLFMGGEFG
QFIEWKDEDQLDWFLLDYDSHRSLHTYSKALNHLYLQEKALWELDHSWDGYQWIEAEDRG
QSVITYLRKGKKTGDTLVVLINFQPVQRENYRIGLQKAGSYMELLNSDHKDFGGSGQVNS
GAIRTSKIPYHGQLHSLEVTIPPLSIVILKKTPPRRSKKAD
NT seq 1926 nt NT seq  +upstreamnt  +downstreamnt
atgacagaccaaactcttccgcaacagactatctcatcggaagatatttatttgtttcat
gaaggaacgctttatcacagctaccgatctttgggttcccaccttactgtggagaacgga
gaacagggcgttcgttttacggtctgggctcctcatgctctccatgtcgggcttgctaca
gatcgcaacaactggaatggggaacaggattccttatatagggttcccaaatccggtttt
tggagtcgtttttttccgaggatatcccaaggaacattttacaaatacgacattacaggt
ccaaatggtgaacgatttctgaaagcagatccttacgccgtacgtgctgaagtgagaccg
gctacggcttcagtggtatcttcattggatggttatgtttggaacgatgcagcttggcgc
cgtaaacgtagagcaccttatggtaaacctctacatatatacgagcttcatctaggcact
tggaagcaaaaagcagatggtacgttttatacatacagggaaatggctgagcttcttgtg
ccttatgtaactgatatgggatatacacatattgagctgatgccgctgagtgagcatccg
tatgatctttcctggggctaccaattaacaggatattttgcactcacaagccgttatggt
gaaccacatgattttatgtatttagtggatcgttgccatcaggcgggaattggagtgatt
atggattgggttccggctcattttgccaaggatgctcatggattgagacggtttgacgga
tcgccactgttcgaatacgcggacccgctaattgctgaaaagcccggttggggaacccta
acgttcgattatagcaagccggaagtacgttcttttctgatctccaacgcattgttctgg
atggatgtgtaccatattgatggtctgcgtgtggatgcggtgacgagcatgttacggctg
gattttgaaaagcaggaaggacaatattgtctcaattccaagggagggattgaaaatgag
gaggctatcgccttccttcaacagctgaatgagacggtattccgctattatccatatgca
ctcatgatggcagaggagtccagcgcttggccgatggtgacctccccagtaagcgatgga
gggctcggttttaattacaaatggaatatgggttggatgaacgatacacttgattatatg
gaatcggagtttgatcaacgacccgaacgccataatttgctgacatttcccatagcctat
gcatacagcgaaaattttacactgccattgtcgcatgatgaggttgttcatggtaagaag
tcgctgcttgataaaatgccgggcacctatgaacaaaaatttgccggactacgggcactc
cttggctaccaaatgacctcaccaggtaaaaagctcttattcatgggaggggaatttggc
cagtttattgaatggaaggatgaggatcagcttgactggtttttgctggactatgacagt
catcggtctttgcacacatattcgaaagcactgaatcatttatatcttcaggagaaagca
ttatgggaattggaccattcgtgggacggctatcaatggattgaagctgaagaccgaggg
cagagtgtgattacgtatttacgtaaaggcaaaaaaacgggggatacactggttgtcctt
attaattttcagcctgtgcaaagagaaaattatcgaattgggttgcaaaaggcaggaagc
tatatggaattgctgaacagcgatcataaggactttgggggaagtggtcaggtaaactcc
ggagcgatacgtacttccaaaatcccttaccacggacagcttcacagcttggaggtgact
attccacccctaagcatcgttatactcaagaagacaccaccacgtagatctaaaaaagca
gattga

DBGET integrated database retrieval system