KEGG   Paenibacillus polymyxa SC2: PPSC2_c2922Help
Entry
PPSC2_c2922       CDS       T01335                                 

Definition
acireductone dioxygenase ard
Orthology
K08967  
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase [EC:1.13.11.53 1.13.11.54]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Cysteine and methionine metabolism
Metabolic pathways
Module
Methionine salvage pathway
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Amino acid metabolism
   00270 Cysteine and methionine metabolism
    PPSC2_c2922
Enzymes [BR:ppm01000]
 1. Oxidoreductases
  1.13  Acting on single donors with incorporation of molecular oxygen (oxygenases)
   1.13.11  With incorporation of two atoms of oxygen
    1.13.11.53  acireductone dioxygenase (Ni2+-requiring)
     PPSC2_c2922
    1.13.11.54  acireductone dioxygenase [iron(II)-requiring]
     PPSC2_c2922
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3104521..3105063
Genome map
AA seq 180 aa AA seqDB search
MAEIFIRNTNERISGEEQVREFLESHQVLYEHWDASKLPRELQENFTLTDDQKAAVLKTF
EPEIKDLAARRGYKIWDVITLSEATPKLDELLAKFEQIHTHTEDEIRAIVAGKGIFIIKG
SEEIGYFNVELSPGDVISVPENTPHFFTLMENQKIVAVRLFIEENGWIAEPFEDPTFTTA
NT seq 543 nt NT seq  +upstreamnt  +downstreamnt
atggcagaaatttttatacgcaatacgaatgagcgaattagtggtgaagaacaagtacgt
gaatttttggagagccaccaagtattgtatgaacactgggatgcttccaagctgccaagg
gagctgcaagaaaactttactctgacagatgatcaaaaagccgctgttcttaaaacattt
gaacctgaaatcaaggatttagccgcacgtcgcggatataaaatatgggacgttatcacc
ttatctgaagcaacgccgaaactggacgagctgctggccaagttcgagcaaattcacacc
cataccgaggatgagatccgtgccattgttgctggtaaaggcattttcatcattaaaggc
tctgaagagatcggctattttaatgtagagctttcaccaggtgacgttatttccgtacct
gaaaatacaccgcacttcttcactttaatggaaaatcaaaagatcgtcgcagtccgcttg
ttcatcgaagaaaatggctggattgccgaaccgttcgaagatccaacattcactacagca
taa

DBGET integrated database retrieval system