KEGG   Paenibacillus polymyxa SC2: PPSC2_c3110Help
Entry
PPSC2_c3110       CDS       T01335                                 

Definition
indole-3-glycerol phosphate synthase
Orthology
K01609  
indole-3-glycerol phosphate synthase [EC:4.1.1.48]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Phenylalanine, tyrosine and tryptophan biosynthesis
Metabolic pathways
Biosynthesis of secondary metabolites
Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PPSC2_c3110
  Amino acid metabolism
   00400 Phenylalanine, tyrosine and tryptophan biosynthesis
    PPSC2_c3110
Enzymes [BR:ppm01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.48  indole-3-glycerol-phosphate synthase
     PPSC2_c3110
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3291170..3291964)
Genome map
AA seq 264 aa AA seqDB search
MYLDKIVVTKRQEVEQLKQHFQINKAERLIADLPVTRGFENALASGRNRPLGLIAEVKKA
SPSKGLIRPDFYPVDIARAYEGAGADCISVLTDVTYFQGSPEYLQQIRDQVKIPLLRKDF
IIDERQIYEARLLGADAVLLIAAILEPHVLGSFLQIAKDLGLDALVEVHDSEELKTVLDL
GTATLIGVNNRNLRTFETRLQTTEELISLIPKGVTFISESGIAGPEDVKYLHSVGAHGIL
VGEHLMRKEDVGQAVAELMDGVRA
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgtatcttgataaaatcgtggtgacgaagcgacaagaagtggagcagctgaagcagcat
tttcaaattaataaagccgaacgcttaattgcggatttacctgtgacgagaggattcgaa
aatgcgctcgccagcggacgcaaccgtccgctcgggctgattgctgaagtgaagaaagct
tccccgtcaaaagggttgattcgacctgatttttatccggtggatatcgcacgtgcatat
gagggggcaggagccgattgcatttctgtactgacagatgtgacgtattttcagggaagt
cctgaatatttacagcaaattcgcgatcaggtgaaaattccgctgctgcgaaaagatttt
atcattgatgaacggcaaatatatgaagctcgtctgttaggagcagatgcggtactgttg
attgcggctatcttggaaccccatgtattagggtcattcttacaaatcgccaaggatctt
ggtctggatgcattggtagaggtgcatgacagtgaggaacttaaaacagtgctggacctg
gggacagcaaccttaattggtgtgaacaatcgtaatcttcggacatttgagacccgtctc
cagacgacagaggagctgatctcactgatcccaaaaggggttacattcatcagcgaaagc
ggcattgcaggaccggaagatgtgaagtatctgcattcggtaggtgcgcacggcattctg
gtaggggagcatttgatgcgtaaggaagatgtaggacaggctgtagccgaattgatggac
ggggttagagcatga

DBGET integrated database retrieval system