KEGG   Paenibacillus polymyxa SC2: PPSC2_c3173Help
Entry
PPSC2_c3173       CDS       T01335                                 

Definition
pyruvate:ferredoxin oxidoreductase and like 2-oxoacid:ferredoxin oxidoreductase alpha subunit
Orthology
K00169  
pyruvate ferredoxin oxidoreductase, alpha subunit [EC:1.2.7.1]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Glycolysis / Gluconeogenesis
Citrate cycle (TCA cycle)
Pyruvate metabolism
Propanoate metabolism
Butanoate metabolism
Methane metabolism
Metabolic pathways
Microbial metabolism in diverse environments
Carbon metabolism
Module
Pyruvate oxidation, pyruvate => acetyl-CoA
Class
Metabolism; Overview; Carbon metabolism [PATH:ppm01200]
Metabolism; Carbohydrate metabolism; Glycolysis / Gluconeogenesis [PATH:ppm00010]
Metabolism; Carbohydrate metabolism; Citrate cycle (TCA cycle) [PATH:ppm00020]
Metabolism; Carbohydrate metabolism; Pyruvate metabolism [PATH:ppm00620]
Metabolism; Carbohydrate metabolism; Propanoate metabolism [PATH:ppm00640]
Metabolism; Carbohydrate metabolism; Butanoate metabolism [PATH:ppm00650]
Metabolism; Energy metabolism; Methane metabolism [PATH:ppm00680]
Metabolism; Xenobiotics biodegradation and metabolism; Nitrotoluene degradation
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3342672..3344960)
Genome map
AA seq 762 aa AA seqDB search
MAKLEEELKQTGAAQVTTFESGNEMAATAAAQINYHMMGYFPITPSTEVAQYLDQMKTRG
QHNIKLVAADGEHGSAGICYGAAAAGARVVNATSSQGFLYMLEQLPVQSGTRFPMVMNLV
TRAVSGPLDIRGDHSDLYYGLNTGWVILTASTPQAVYDMNIMALKIAEHSDVRLPVMVAY
DGFYTSHQKRKVQYFADAETVRDFVGPNPNLNYPNITDFDHPVTVGAHMNGDDLTNNHVQ
LSEALKLSEGVYEQVAAEYAALSGREYPILDLYHMEDAEVAVFLLNSAAESAKDVADQLR
TRGIKAGVIRPNIIRPFPAAQLREALRHVKALLVGERADSYGSDGGNLTHEIKAALQEDP
LNQTIVLSRIFGLGGKDFYAEDAEAFFQLAIQAAEAGRAEKPFDYYGVNPGSPDKVMPQV
MQPPRGNAYRTGLIQVTPDEATGKLKVKVPPLRSLTTKPRRLTPGHGACPGCGALSALEL
FFKGIEGDIVVLFQTGCVYVVTTGYPYTSHKQPMIHNLFQNGAATLSGALEAYMEMKRRN
EIEISDDPTFIMISGDGGMDIGMGSAIGAALRNHKLIMLEYDNEGYMNTGSQQSYSTPMG
HMTSTSGVGKMQKGKQGHHKDTVQIMAACNIPYAFTAAESHPQDMLRKAAKAQWYANNVG
TAYGKILCACPLNWKSEDRLGTSIVGAAVESCFFPLYEIEQGSTTITYNPEDKGKRIPAA
EWLKLMGKTKHLLKEEATLATFEQEIERRWTILKKKHEISEL
NT seq 2289 nt NT seq  +upstreamnt  +downstreamnt
atggcaaagctggaggaagaactcaaacagacgggcgccgcacaagtgacaacattcgaa
tccggtaatgaaatggcagctacggcggctgcgcagatcaattatcatatgatgggatat
ttcccgattacgccgtcgactgaggtagcacagtatctggatcaaatgaaaacgcgtggt
cagcataatattaaactggttgcagcagatggagaacacggatcggcagggatttgttat
ggagctgcggcagcaggagcgcgggttgtgaacgctaccagttcgcaaggtttcctatac
atgctggagcagttgcctgttcagtcgggtacccgttttcctatggttatgaatctggtg
acaagagctgtcagtggtcccttggatattcggggggatcattcggacctgtattatggt
ttgaatacaggctgggtcattttgacggcaagtacgccacaggctgtgtatgatatgaac
attatggccctgaaaattgcagagcatagcgatgtacgattgcctgtaatggtcgcatac
gacggtttttatacgtcccatcaaaaacgtaaagtgcaatattttgccgatgcagagacc
gtgcgcgattttgtaggccccaacccgaacctaaattatccgaatattacggattttgat
catcctgtcactgtgggtgcgcatatgaacggcgatgatctgacgaataatcacgttcaa
ctgtccgaagcgttgaagctttcagaaggagtatatgagcaggtagcagcagaatatgcc
gctttatccggtcgggaatatccgattttggatctgtatcatatggaggatgctgaggtt
gcggtatttttgctgaattcggcggctgaatcggccaaggatgtggcagatcaactccgc
acgcgcggcattaaagccggtgtgattcgtccgaatatcatccggccattcccagctgca
caactgcgggaggcattgcgccatgtcaaggcgctgttggtgggtgaacgtgcagattcg
tacgggtcagatggtggtaatttgacgcatgaaatcaaggcggcgttgcaagaggacccg
ttgaaccaaaccatcgtgttaagccgtatctttggcttgggtggtaaggacttttatgcg
gaagatgcagaggccttcttccagcttgcgattcaggcggcagaggctggacgcgcggag
aagccttttgattattacggggttaatccaggctctccagacaaggtgatgccgcaagtc
atgcagccaccacgtggcaatgcataccgtacggggctgattcaggttacgccggacgag
gcgactgggaagctcaaagtcaaggtaccacctctgcgttcgttgacaaccaaaccacgc
cgtcttacaccagggcatggggcttgtcctggttgtggagccttgtctgcgcttgagcta
ttttttaaaggaattgaaggcgatattgtcgtactattccagactggctgcgtttatgtg
gtgacgacagggtatccatatacatcacacaagcaaccgatgatccacaatctttttcaa
aacggggccgctaccctttcaggtgcgctggaagcttacatggagatgaagcgacgtaat
gaaattgagatatccgatgatccaacctttatcatgatcagtggtgacggcgggatggat
atcggtatgggttctgcaattggtgcggctctgcgtaaccataaactgattatgctggaa
tatgacaacgaggggtacatgaatacaggttcgcagcaatcgtactccactccaatgggg
catatgaccagtacatcgggtgtagggaaaatgcaaaaagggaagcaagggcatcataag
gataccgtacaaatcatggccgcctgtaacatcccgtatgcttttaccgcagccgaaagc
catccgcaggatatgctgcgcaaagcggccaaggctcaatggtatgccaacaacgtgggt
acggcatatggtaaaattctgtgtgcctgcccgctcaactggaaatccgaagacagactg
ggtactagcatcgtaggcgccgcagttgagtcttgcttctttcctttgtacgaaatcgaa
cagggaagcacgacgattacgtacaatccggaagacaagggaaaacggattccagccgca
gaatggctgaaattaatgggtaaaacgaagcatcttctcaaagaggaagcaacgctggct
acctttgagcaggagattgagcgtcgctggactatcctgaaaaagaaacatgaaatttcg
gagttataa

DBGET integrated database retrieval system