KEGG   Paenibacillus polymyxa SC2: PPSC2_c3304Help
Entry
PPSC2_c3304       CDS       T01335                                 

Definition
guanylate kinase
Orthology
K00942  
guanylate kinase [EC:2.7.4.8]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Purine metabolism
Metabolic pathways
Module
Guanine ribonucleotide biosynthesis IMP => GDP,GTP
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Nucleotide metabolism
   00230 Purine metabolism
    PPSC2_c3304
Enzymes [BR:ppm01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.4  Phosphotransferases with a phosphate group as acceptor
    2.7.4.8  guanylate kinase
     PPSC2_c3304
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3473269..3473841)
Genome map
AA seq 190 aa AA seqDB search
MAKGLLFVISGPSGVGKGTVGNALREKLPEITYSVSATTRTPRSGEQDGVTYFFKTREEF
LGMIERDELLEYAEYVGNYYGTPRDFVDQTLAQGKDIFLEIEVQGALKVKEKFPEGIFIF
LLPPSLDELKDRIRGRGTETQATIDHRMSVAVDEMNLLRHYDYAVVNDEIDFACKRIESI
IIAEHCKVRP
NT seq 573 nt NT seq  +upstreamnt  +downstreamnt
atggctaagggattattatttgtaatatctggaccttcgggggtcggcaaagggacggta
ggcaatgcattgcgcgaaaagctacctgagataacgtattccgtttctgctacaactcga
acacctcgttcgggcgagcaggatggagtgacctattttttcaaaacgcgtgaagaattt
ttaggcatgattgaacgagatgaattgctggagtacgcagagtatgtaggtaactactat
ggcactccacgtgattttgtagaccagacgcttgcgcagggtaaagatatctttctggaa
attgaagttcagggcgcgctaaaggttaaagaaaaattcccggaaggcatattcattttc
ttgcttccgccttcactggatgaattgaaggatagaattcggggacgtggcacagaaact
caagcaaccattgatcaccgtatgtcggtagctgtggacgagatgaacttgttacgtcac
tatgattatgcggttgtcaatgatgagattgatttcgcttgtaaacgaatagaatccatt
attatcgccgaacattgtaaggttcgaccttaa

  All links  
No link information was found.   
DBGET integrated database retrieval system