KEGG   Paenibacillus polymyxa SC2: PPSC2_c3333Help
Entry
PPSC2_c3333       CDS       T01335                                 

Definition
AMP-dependent synthetase/ligase
Orthology
K01895  
acetyl-CoA synthetase [EC:6.2.1.1]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Glycolysis / Gluconeogenesis
Pyruvate metabolism
Propanoate metabolism
Methane metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Carbon metabolism
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Overview
   01200 Carbon metabolism
    PPSC2_c3333
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    PPSC2_c3333
   00620 Pyruvate metabolism
    PPSC2_c3333
   00640 Propanoate metabolism
    PPSC2_c3333
  Energy metabolism
   00680 Methane metabolism
    PPSC2_c3333
Enzymes [BR:ppm01000]
 6. Ligases
  6.2  Forming carbon-sulfur bonds
   6.2.1  Acid-thiol ligases
    6.2.1.1  acetate---CoA ligase
     PPSC2_c3333
Lipid biosynthesis proteins [BR:ppm01004]
 Acyl-CoA synthetase
  Short/medium chain acyl-CoA synthetase
   PPSC2_c3333
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3508940..3510655)
Genome map
AA seq 571 aa AA seqDB search
MKIEELQAVVPTSNMGSYEQAYNNFQWEDVERHFTWYETGKVNMAHEAIDRHVEEGRGEK
AALLYCDANRHETYTFSQLRASSNRFGNVLRKYGIGKGERVFIFMPRSPELVISMLGVLK
VGAVVGPLFEAFMETAIKDRLEDSGAVALVTTPALLSRVKREELPELRHIFVVGDMDERE
QGIIDFETEMLTSSEELEPEWLSREDGLIIHYTSGSTGKPKGVYHVQNAMIQHYYTGKTV
LDLREDDVYWCTADPGWVTGTSYGIFAPWLNGATNVIRGGRFSPEDWYRTIERHEVTIWY
SAPTAFRMLMSAGEQVVSNYDLSSLRHVLSVGEPLNPEVVRWGWQVYTQRIHDTWWMTET
GGQLICNYPELPIKPGSMGKPLPGIQAAILDDRGQVLPPNRMGHLAIRTPWPSMMNRIWN
NPNKFQEYFRFPGWYVSGDSAYMDEDGYFWFQGRIDDVINSSGERIGPFEVESKLLEHPA
VAEAGVIGKPDTVRGEIIKAFVALRDGYTASEALQQDIYRFVKEGLSAHAAPREIEFKEK
LPKTRSGKIMRRVLKAWELNLPTGDLSTIED
NT seq 1716 nt NT seq  +upstreamnt  +downstreamnt
atgaagattgaagaactccaggctgtagttcccacatccaacatgggctcttatgaacaa
gcttacaacaactttcagtgggaagatgtagaacgtcattttacgtggtatgaaacaggc
aaagtgaatatggcacatgaagcgattgatcgacatgtagaggaaggacggggggagaaa
gcagcacttttgtattgtgatgcaaaccgtcatgaaacctacactttttctcagcttcgt
gccagctcgaacaggttcggaaatgtgctgcgcaaatacggtattggtaaaggggaacgg
gtgtttatattcatgccgcgttcacctgaactggtcattagtatgcttggggttttaaag
gtaggcgctgttgtcggcccactgtttgaggcgtttatggaaacggcgattaaagatcgc
ttggaggatagcggggcggtggcattagtaaccacacctgcgcttctttcacgggtaaaa
cgtgaggagcttcctgagttgcgtcatatttttgtggtcggtgatatggacgaacgggag
cagggaattattgatttcgaaacggaaatgctcacatcctcagaagagcttgagcccgaa
tggctgagtcgtgaagatggattaattattcactatacatcaggctcaacgggcaagccc
aaaggcgtgtatcatgtacaaaatgcaatgattcagcattactatacgggtaaaacggtg
ctggatctgcgggaagatgatgtatattggtgtactgcggatcctggctgggttacggga
acgtcatatggcatttttgctccttggctaaatggagcaacaaatgtcatccgtggaggc
cgtttcagcccagaggactggtaccgtacgattgaacgtcacgaagtgacgatttggtat
agtgctcctacggcgtttcggatgttgatgagcgcaggggagcaggtagtttccaactat
gatctcagcagcttgcggcatgtattatccgttggggagccactgaatcccgaggtagtg
agatggggctggcaagtatacacacagcgtattcatgatacttggtggatgacggaaaca
ggaggccagttgatctgtaattacccagagctgccgattaaaccaggttcgatgggaaag
ccacttccaggtattcaagctgctattttggacgacagaggccaggtgttgcctcctaat
aggatgggacatttggcgattcgtacaccatggccatccatgatgaaccgtatatggaac
aacccaaataagtttcaggaatatttccgctttcccggttggtatgtatccggtgattca
gcttacatggatgaggacggatacttctggtttcagggaagaattgatgatgttatcaac
tcctccggagagcgcatcggtccttttgaggtggagagcaagcttctggagcatcctgct
gtagcggaagctggagtcattgggaaaccagatactgttcgaggagagatcattaaagca
tttgtcgccctgcgtgatggctataccgcgtcggaagcgttacaacaggacatttaccgc
ttcgtcaaggaagggctgtctgctcatgctgctccgcgtgaaattgaatttaaggaaaag
ttacccaaaacccgttccggcaaaattatgagacgtgtgctgaaagcctgggagcttaac
cttcctacaggtgacctgtctaccattgaggattga

  All links  
No link information was found.   
DBGET integrated database retrieval system