KEGG   Paenibacillus polymyxa SC2: PPSC2_c3432Help
Entry
PPSC2_c3432       CDS       T01335                                 

Definition
pectinesterase
Orthology
K01051  
pectinesterase [EC:3.1.1.11]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Pentose and glucuronate interconversions
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    PPSC2_c3432
   00500 Starch and sucrose metabolism
    PPSC2_c3432
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.1  Carboxylic-ester hydrolases
    3.1.1.11  pectinesterase
     PPSC2_c3432
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3652385..3653362)
Genome map
AA seq 325 aa AA seqDB search
MLVGKESFCDFHTIQEAINVLEQSPSNEMETLTILSGTYEEEVRIYRSNLHIIGIGQVEI
RMNRYARERNESGEEIGTFATPTLFVGGSHLILENLIISNTAGQGEHIGQAVAVYAHCDQ
TIFRNCTFKGYQDTLFTGPLPPAPKERLKFGGIPLKEHHAYYRQLYQHCYIEGTIDFIFG
GATAYFEDCEIRSLRHHKNHTSYVTAASTPQGQTYGYVFDHCYLTAEPDITPVFLGRPWR
EYAKTVFVNCKMGDHIDPRGWDNWDTVANEKTVCYQEYGGSDEIASLRQQRVPWADCFEA
RTEAWSKEQVFEGVAFWKARRSDVS
NT seq 978 nt NT seq  +upstreamnt  +downstreamnt
atgctagtcggaaaagaatccttttgtgatttccacaccattcaggaggcgattaatgta
ttggagcaatcgccttccaacgaaatggaaacgctaactattttatcgggtacctatgag
gaagaggtgcggatttaccgttcaaatctacatatcataggcatcggacaggtagaaatt
cgaatgaatcggtacgccagggagcggaatgaatcaggtgaggaaataggaacctttgca
acacccactttatttgtaggcggcagccatttgatcttggaaaatctcatcatttccaac
acggccggacagggagaacacattgggcaggccgttgcggtatacgctcattgtgatcaa
accatctttagaaactgcacctttaaagggtaccaggacacgttatttacaggccctctg
cctcctgcacccaaagaacgattaaagtttggtggaattcctttgaaagaacatcacgca
tactatcgccagctttatcagcattgttacatcgagggtacgatagacttcatttttggc
ggggctaccgcttactttgaagattgcgagattcgtagtttgcgtcatcataagaaccat
acaagctacgttacagccgcctctacaccgcaaggacaaacgtacggctatgtatttgat
cattgctatttaaccgcagagcctgatattacccctgtttttttgggtcgtccatggcgg
gaatatgccaaaaccgtatttgtcaattgtaaaatgggcgaccatatcgatccgcgtggc
tgggacaattgggacactgtagcgaacgagaaaaccgtatgctatcaggaatatggcgga
tctgatgaaatagcttcattacgtcagcagcgtgttccgtgggcggattgttttgaagcg
aggacagaagcatggagcaaggaacaggtttttgagggagtcgcattttggaaagcaagg
agaagtgatgtctcatga

DBGET integrated database retrieval system