KEGG   Paenibacillus polymyxa SC2: PPSC2_c3524Help
Entry
PPSC2_c3524       CDS       T01335                                 

Definition
aspartate carbamoyltransferase
Orthology
K00609  
aspartate carbamoyltransferase catalytic subunit [EC:2.1.3.2]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Pyrimidine metabolism
Alanine, aspartate and glutamate metabolism
Metabolic pathways
Class
Metabolism; Nucleotide metabolism; Pyrimidine metabolism [PATH:ppm00240]
Metabolism; Amino acid metabolism; Alanine, aspartate and glutamate metabolism [PATH:ppm00250]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(3729641..3730555)
Genome map
AA seq 304 aa AA seqDB search
MITTASQLRERSLLGLKELSRNEIESILDRAHYWETQPQKLIPVLQSRFAANMFFENSTR
TRFSFEMAEKRLGAQVLNFSAAASSVEKGESIYDTVRTLESMGIDAGVIRLKPAGVLQEL
AEKVSVPLVNAGDGNNEHPTQALLDLYTMRKTFGELKGLRVSIIGDILHSRVARSNLWAL
QKFGAKVSFCAPDNMQAPELATYAPYVPMQEALQADVVMMLRVQLERHAEGMLRSADEYR
EQYGLTEERAASLKSGTIIMHPAPVNRNVEIDSAVVESEQSRIFPQMANGVPIRMAVMER
AMKL
NT seq 915 nt NT seq  +upstreamnt  +downstreamnt
atgatcacaacagccagtcaacttagagaacgtagcctgctcggattaaaagaacttagc
cgaaatgaaattgagtcgattctggatcgtgctcattattgggaaacacagccgcaaaag
ctgattccagtcctacagtcacgcttcgcggccaacatgttttttgaaaatagtacacgc
acacgcttttcttttgaaatggcggagaagcggctcggcgctcaggttttgaacttttcc
gctgcggcttccagtgtggaaaaaggggagtccatttacgatactgtacgtacgctcgaa
tccatgggcattgatgctggagtcatccggttaaagccagccggagtgctgcaagagctt
gctgagaaggtcagtgttccgctggttaatgcgggagacggcaacaatgagcatccaacg
caggctttactggacctctacaccatgcgcaaaactttcggtgagcttaaaggcttgaga
gtatccatcataggagacattttgcacagccgtgtagctcgctcgaatctgtgggccttg
caaaaattcggagccaaggttagcttctgtgcaccggacaatatgcaggcacctgagctt
gcaacgtacgcgccttatgtgccgatgcaagaagctttgcaggcagacgtggtcatgatg
ctgcgagtccagcttgaacggcatgctgaaggaatgttgcgctcagcggatgagtaccga
gagcagtacggtctgacagaagaaagagcagcgagccttaagtccggaacaattatcatg
cacccggctccagtgaatcggaatgtggagatcgacagtgcagttgtggaaagcgagcaa
tcacgaatttttccgcaaatggccaacggggttccgatccgcatggcggttatggaacgg
gcaatgaagctgtag

DBGET integrated database retrieval system