KEGG   Paenibacillus polymyxa SC2: PPSC2_c3726Help
Entry
PPSC2_c3726       CDS       T01335                                 

Definition
bifunctional reductase 1
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Class
Metabolism; Lipid metabolism; Fatty acid degradation [PATH:ppm00071]
Metabolism; Amino acid metabolism; Tryptophan metabolism [PATH:ppm00380]
Metabolism; Xenobiotics biodegradation and metabolism; Aminobenzoate degradation [PATH:ppm00627]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3939794..3942970
Genome map
AA seq 1058 aa AA seqDB search
MTSTNSIPQPKTYGPLGNLPLIDTHAPVQSLVKLANEHGPIFRMDLPEGTNIYISGHKLV
ADACDESRFDKQVWAPLQKVRAFAGDGLFTSWTEEPNWRKAHQILLPSFSQRAMKGYHNM
MLDLAVQLVQKWSRLNPDESVEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFVTSMT
RALDEAMGQLQRLNLQNKLMLSKKKQFKHDIETMFSLVDSIIQERKTVGNQGEEDLLARM
LEGKDPETGETLDDENIRYQIITFLIAGHETTSGLLSFAIYYLLKNPRTLTKAYEEVDRV
LTDSLPSYTQVRELKYIRMILNEALRLWPTAPAFSLFAKEDTLLDGTYPLKKGDSVNVLI
PKLHRDTEAWGEDVEEFRPERFEDPSAIPQDAYKPFGNGQRACIGQQFALQEATLVLGMV
LKHFELIDHTHYELKVKETLTLKPGGFTIQVRPRSTQTTIMLPGAAQELHEKEEQKVAAP
HAEKHDTSLLSLYGSNLGTAEGLAGELADLGRNWGFKSSIATLNDHVDHLPKEGVVLITT
ATYNGHPPDNADAFVEWLKEVDEGQLAGIRYAVFGCGDRNWASTYQRIPRMIDELMTAKG
AKRLYDRGEGDASGDFEKDWEVWNHGLWPELLNAFGIEHSDTEPQDTSSLSIEFVSDVLS
APLAANYEAATAVVTVNRELHAAESERSTRHLEIQLPTGLSYREGDHLGVLPRNPALLVN
RVMQRFKLQDQNYIVLRGSDRDAAHLPLDRPVSVGDLLTLSVELQEPATRAQLRQLASFT
VCPPHKKEIEALLEDTTFDQEIRKKRVTMLDILEKYPACELPFENFISLLPPLKPRYYSI
SSSPLESENSASITVSVVRGPARSGQGEYLGIASNYLAQLQPDDPVVIFVRKPQSGFRLP
EDPTVPVIMVGPGTGVAPFRGFLQTRHVLKERGEQLGEAHLYYGCRDPKLDYLYKQELQT
WEQEGIVTVHTAFSRLPGQPKRYVQHVMNEGADTLIHLLDEGAHLYVCGDGSRMAPDVEN
TLCAAYADIHHTSKEEAQQWLDHLQQEKRYAKDVWTGI
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaacaaattcaattccgcagcctaaaacatatggtcccttaggaaatctgccc
ttgatcgatacacatgcccctgtccagtctctggttaagcttgctaatgagcacggtccc
atctttcgcatggatctgcctgaaggaacgaacatttatatttccggtcataagctggtc
gcagatgcttgtgatgaatcccgtttcgacaaacaggtgtgggctcccttacaaaaagta
cgagcttttgccggagacggactattcacaagctggactgaggaaccgaactggcgcaag
gcccaccaaatattgctaccaagcttcagtcagcgggctatgaagggttaccacaatatg
atgcttgatcttgctgttcagctggtacagaaatggtctcggctcaatccagatgaaagt
gtagaggtaccggaagatatgacccggctgactttggataccatcggattatgcggcttt
aattatcgttttaacagcttttaccgcgaccagccccatccgttcgtgaccagtatgaca
cgcgcactggatgaagcaatgggtcagttgcaacgcctcaatttgcaaaacaagctgatg
ttatcgaagaaaaaacagtttaaacacgacatcgaaacgatgttctctctagtggacagc
attattcaagaacgcaaaaccgtgggcaaccaaggtgaagaggatttactggcacgtatg
ctggaaggcaaggacccggaaacaggtgaaacgctggatgatgaaaatatccgttatcag
atcatcacctttctcatcgccggtcatgaaacgaccagtgggcttttatcctttgccatt
tactatttgcttaaaaatccacgaacgctaactaaagcctatgaagaagtagatcgcgtg
ctcaccgattcgctgccttcctatactcaggtgcgtgagctcaagtacataaggatgata
ctgaatgaagctctgcgactatggccgacagcgcccgccttctctctctttgccaaagaa
gatacactgctcgacggaacctatccgcttaaaaaaggcgacagcgtcaatgtactcatc
ccgaaactgcaccgtgataccgaggcttggggcgaagatgttgaggaatttcgaccggaa
cgcttcgaggacccttccgccattccgcaagatgcctacaaaccctttggcaacggtcaa
cgggcctgtattggacaacagttcgccttacaggaggccacccttgtgctggggatggta
ctgaaacattttgagctgattgatcatactcattatgagttgaaagtcaaagaaacgctc
acactcaagccgggaggcttcaccattcaagtacgtccgcgcagcacacagactaccatc
atgttgccaggtgccgctcaagaacttcatgaaaaggaggaacaaaaagttgcagccccc
catgccgaaaagcatgatacttctttgttgtctttatacggctcgaatctgggtacagct
gagggacttgcaggtgaactagccgatttaggtcggaattggggtttcaagagcagcata
gcaactctgaatgatcatgtggaccatttgcctaaagaaggcgtggtacttattacgacc
gcaacttataacgggcatccgccggataatgctgatgccttcgtagaatggttgaaggag
gtagatgagggacaattggcaggcataaggtacgctgtctttggttgcggtgaccggaat
tgggccagcacgtatcagcgcattccaaggatgatcgatgaactgatgactgccaaaggg
gcaaaacgactgtatgatcgcggcgagggcgacgctagtggtgacttcgagaaggattgg
gaagtctggaaccacggcttatggccggaattgctgaatgctttcgggatagagcacagt
gatacagaaccacaggacaccagcagtctgagcatagagtttgtaagcgacgtacttagc
gctcctctggcggccaactatgaggcagctactgccgttgttactgtgaatcgtgaactg
cacgctgctgaaagtgaacgcagtactcggcatctggagatccaattaccaaccggattg
tcctatcgcgagggtgatcatctgggtgttttgccgcgtaatcctgctttgctggtgaat
agggtaatgcaacgctttaagttgcaggatcaaaactacatcgtattgagaggcagtgac
cgggatgcggcgcatctccccttagatcggcctgtcagcgtaggagatttgctcactctc
agtgtggaactgcaagaaccggcaaccagagcccagctacggcaactggcatcctttaca
gtgtgtcctccgcacaagaaagaaatcgaagctttgctagaggataccacctttgatcaa
gagatacgaaagaagcgtgtcacgatgctagatattctggagaagtatccagcctgtgag
ctgccatttgaaaatttcatctcactgttaccaccactcaagcctagatactactccatc
tccagttctccgcttgaatcggagaattcagcgagtataactgtgagcgttgtgcgtgga
ccagcccgtagcggacagggcgaatacctcggtattgcctccaattatttggcacagctc
caaccagatgatccggttgtcatttttgtgcgaaagcctcagtctggcttccgtttgccg
gaagacccgaccgttcctgtcatcatggtcggtccgggtactggcgttgccccattccgc
ggatttctccaaacacgccatgtgcttaaggagagaggagaacagctcggcgaggctcat
ttatactatggctgccgtgatccaaagctcgattatctatacaagcaagagctgcaaacc
tgggagcaggaaggaatcgttacggttcatacagccttttcacgtctgcctggtcaacct
aaaaggtatgtacagcacgttatgaatgaaggggcagacactctgattcacttgcttgat
gaaggagcgcatctgtatgtatgcggtgatggtagccggatggcccccgacgttgaaaac
acgctctgtgcggcttacgcggatatacaccatacaagtaaagaagaagcgcagcaatgg
ttggatcatctccaacaggaaaaacgctatgccaaggatgtctggacaggtatctga

DBGET integrated database retrieval system