KEGG   Paenibacillus polymyxa SC2: PPSC2_c3726Help
Entry
PPSC2_c3726       CDS       T01335                                 

Definition
bifunctional reductase 1
Orthology
K14338  
cytochrome P450 / NADPH-cytochrome P450 reductase [EC:1.14.14.1 1.6.2.4]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Fatty acid degradation
Tryptophan metabolism
Aminobenzoate degradation
Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Lipid metabolism
   00071 Fatty acid degradation
    PPSC2_c3726
  Amino acid metabolism
   00380 Tryptophan metabolism
    PPSC2_c3726
  Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    PPSC2_c3726
Enzymes [BR:ppm01000]
 1. Oxidoreductases
  1.6  Acting on NADH or NADPH
   1.6.2  With a heme protein as acceptor
    1.6.2.4  NADPH---hemoprotein reductase
     PPSC2_c3726
  1.14  Acting on paired donors with incorporation of molecular oxygen
   1.14.14  With reduced flavin or flavoprotein as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.14.1  unspecific monooxygenase
     PPSC2_c3726
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
3939794..3942970
Genome map
AA seq 1058 aa AA seqDB search
MTSTNSIPQPKTYGPLGNLPLIDTHAPVQSLVKLANEHGPIFRMDLPEGTNIYISGHKLV
ADACDESRFDKQVWAPLQKVRAFAGDGLFTSWTEEPNWRKAHQILLPSFSQRAMKGYHNM
MLDLAVQLVQKWSRLNPDESVEVPEDMTRLTLDTIGLCGFNYRFNSFYRDQPHPFVTSMT
RALDEAMGQLQRLNLQNKLMLSKKKQFKHDIETMFSLVDSIIQERKTVGNQGEEDLLARM
LEGKDPETGETLDDENIRYQIITFLIAGHETTSGLLSFAIYYLLKNPRTLTKAYEEVDRV
LTDSLPSYTQVRELKYIRMILNEALRLWPTAPAFSLFAKEDTLLDGTYPLKKGDSVNVLI
PKLHRDTEAWGEDVEEFRPERFEDPSAIPQDAYKPFGNGQRACIGQQFALQEATLVLGMV
LKHFELIDHTHYELKVKETLTLKPGGFTIQVRPRSTQTTIMLPGAAQELHEKEEQKVAAP
HAEKHDTSLLSLYGSNLGTAEGLAGELADLGRNWGFKSSIATLNDHVDHLPKEGVVLITT
ATYNGHPPDNADAFVEWLKEVDEGQLAGIRYAVFGCGDRNWASTYQRIPRMIDELMTAKG
AKRLYDRGEGDASGDFEKDWEVWNHGLWPELLNAFGIEHSDTEPQDTSSLSIEFVSDVLS
APLAANYEAATAVVTVNRELHAAESERSTRHLEIQLPTGLSYREGDHLGVLPRNPALLVN
RVMQRFKLQDQNYIVLRGSDRDAAHLPLDRPVSVGDLLTLSVELQEPATRAQLRQLASFT
VCPPHKKEIEALLEDTTFDQEIRKKRVTMLDILEKYPACELPFENFISLLPPLKPRYYSI
SSSPLESENSASITVSVVRGPARSGQGEYLGIASNYLAQLQPDDPVVIFVRKPQSGFRLP
EDPTVPVIMVGPGTGVAPFRGFLQTRHVLKERGEQLGEAHLYYGCRDPKLDYLYKQELQT
WEQEGIVTVHTAFSRLPGQPKRYVQHVMNEGADTLIHLLDEGAHLYVCGDGSRMAPDVEN
TLCAAYADIHHTSKEEAQQWLDHLQQEKRYAKDVWTGI
NT seq 3177 nt NT seq  +upstreamnt  +downstreamnt
atgacttcaacaaattcaattccgcagcctaaaacatatggtcccttaggaaatctgccc
ttgatcgatacacatgcccctgtccagtctctggttaagcttgctaatgagcacggtccc
atctttcgcatggatctgcctgaaggaacgaacatttatatttccggtcataagctggtc
gcagatgcttgtgatgaatcccgtttcgacaaacaggtgtgggctcccttacaaaaagta
cgagcttttgccggagacggactattcacaagctggactgaggaaccgaactggcgcaag
gcccaccaaatattgctaccaagcttcagtcagcgggctatgaagggttaccacaatatg
atgcttgatcttgctgttcagctggtacagaaatggtctcggctcaatccagatgaaagt
gtagaggtaccggaagatatgacccggctgactttggataccatcggattatgcggcttt
aattatcgttttaacagcttttaccgcgaccagccccatccgttcgtgaccagtatgaca
cgcgcactggatgaagcaatgggtcagttgcaacgcctcaatttgcaaaacaagctgatg
ttatcgaagaaaaaacagtttaaacacgacatcgaaacgatgttctctctagtggacagc
attattcaagaacgcaaaaccgtgggcaaccaaggtgaagaggatttactggcacgtatg
ctggaaggcaaggacccggaaacaggtgaaacgctggatgatgaaaatatccgttatcag
atcatcacctttctcatcgccggtcatgaaacgaccagtgggcttttatcctttgccatt
tactatttgcttaaaaatccacgaacgctaactaaagcctatgaagaagtagatcgcgtg
ctcaccgattcgctgccttcctatactcaggtgcgtgagctcaagtacataaggatgata
ctgaatgaagctctgcgactatggccgacagcgcccgccttctctctctttgccaaagaa
gatacactgctcgacggaacctatccgcttaaaaaaggcgacagcgtcaatgtactcatc
ccgaaactgcaccgtgataccgaggcttggggcgaagatgttgaggaatttcgaccggaa
cgcttcgaggacccttccgccattccgcaagatgcctacaaaccctttggcaacggtcaa
cgggcctgtattggacaacagttcgccttacaggaggccacccttgtgctggggatggta
ctgaaacattttgagctgattgatcatactcattatgagttgaaagtcaaagaaacgctc
acactcaagccgggaggcttcaccattcaagtacgtccgcgcagcacacagactaccatc
atgttgccaggtgccgctcaagaacttcatgaaaaggaggaacaaaaagttgcagccccc
catgccgaaaagcatgatacttctttgttgtctttatacggctcgaatctgggtacagct
gagggacttgcaggtgaactagccgatttaggtcggaattggggtttcaagagcagcata
gcaactctgaatgatcatgtggaccatttgcctaaagaaggcgtggtacttattacgacc
gcaacttataacgggcatccgccggataatgctgatgccttcgtagaatggttgaaggag
gtagatgagggacaattggcaggcataaggtacgctgtctttggttgcggtgaccggaat
tgggccagcacgtatcagcgcattccaaggatgatcgatgaactgatgactgccaaaggg
gcaaaacgactgtatgatcgcggcgagggcgacgctagtggtgacttcgagaaggattgg
gaagtctggaaccacggcttatggccggaattgctgaatgctttcgggatagagcacagt
gatacagaaccacaggacaccagcagtctgagcatagagtttgtaagcgacgtacttagc
gctcctctggcggccaactatgaggcagctactgccgttgttactgtgaatcgtgaactg
cacgctgctgaaagtgaacgcagtactcggcatctggagatccaattaccaaccggattg
tcctatcgcgagggtgatcatctgggtgttttgccgcgtaatcctgctttgctggtgaat
agggtaatgcaacgctttaagttgcaggatcaaaactacatcgtattgagaggcagtgac
cgggatgcggcgcatctccccttagatcggcctgtcagcgtaggagatttgctcactctc
agtgtggaactgcaagaaccggcaaccagagcccagctacggcaactggcatcctttaca
gtgtgtcctccgcacaagaaagaaatcgaagctttgctagaggataccacctttgatcaa
gagatacgaaagaagcgtgtcacgatgctagatattctggagaagtatccagcctgtgag
ctgccatttgaaaatttcatctcactgttaccaccactcaagcctagatactactccatc
tccagttctccgcttgaatcggagaattcagcgagtataactgtgagcgttgtgcgtgga
ccagcccgtagcggacagggcgaatacctcggtattgcctccaattatttggcacagctc
caaccagatgatccggttgtcatttttgtgcgaaagcctcagtctggcttccgtttgccg
gaagacccgaccgttcctgtcatcatggtcggtccgggtactggcgttgccccattccgc
ggatttctccaaacacgccatgtgcttaaggagagaggagaacagctcggcgaggctcat
ttatactatggctgccgtgatccaaagctcgattatctatacaagcaagagctgcaaacc
tgggagcaggaaggaatcgttacggttcatacagccttttcacgtctgcctggtcaacct
aaaaggtatgtacagcacgttatgaatgaaggggcagacactctgattcacttgcttgat
gaaggagcgcatctgtatgtatgcggtgatggtagccggatggcccccgacgttgaaaac
acgctctgtgcggcttacgcggatatacaccatacaagtaaagaagaagcgcagcaatgg
ttggatcatctccaacaggaaaaacgctatgccaaggatgtctggacaggtatctga

DBGET integrated database retrieval system