KEGG   Paenibacillus polymyxa SC2: PPSC2_c3858Help
Entry
PPSC2_c3858       CDS       T01335                                 

Definition
coproporphyrinogen iii oxidase : protoporphyrinogen ix oxidase
Orthology
K00231  
oxygen-dependent protoporphyrinogen oxidase [EC:1.3.3.4]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Porphyrin and chlorophyll metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Class
Metabolism; Metabolism of cofactors and vitamins; Porphyrin and chlorophyll metabolism [PATH:ppm00860]
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4055363..4056784)
Genome map
AA seq 473 aa AA seqDB search
MNKNAKKVVILGGGISGLSAAFYVKKLAEDRQLEVEITLVEKSDRLGGKLQTVRQNHFMI
EKGPDAFLARKTAILDLTMELGLEADLVSTNPKAKSASILHKGKLHTMPMGFILGIPTKL
TPFIRTGLISPLGKARAAMDLIIPAKKGDMDESLGDFIKRRLGKEVLEQITEPLLSGIYA
GDTYSLSLKSTFPQFKQMEQKHGSLIIGMAKGAGRKSGAPNKLPEIAKKSMFLSYRHGLS
TIVERLKEKLDTVQFVMEQRVAEIRKENGYQVVLNQGQIIDADAIICAIPAFEAAKLFSD
ITSVSWLNKINYVSVANISLAYKNSDLRLAYEGTGFLVPRKEGKMITACTWSSTKWSHTA
PEGYTLLRTYIGHAGAQEWVQMTDEELVEAARKDLKDLMGIDAQPKMTEVSRCNQSMPQY
PIGHQEQMAKVRHDLSQYFPNVFLCGAGYGGVGIPDCIAQGKEAAEQLVSGFL
NT seq 1422 nt NT seq  +upstreamnt  +downstreamnt
atgaataaaaatgctaaaaaagttgtgatccttggtggaggaataagcggtttaagtgcc
gctttttatgtgaaaaagctggcagaggacaggcagcttgaagtggagattacactggtg
gagaaaagcgaccgcctgggaggaaagctgcaaacggttcgccaaaaccattttatgatc
gaaaaaggaccagatgctttcctggccagaaagacggctatattggatctgactatggag
ttgggactggaagctgatttggtgtcaacaaacccgaaggccaagtcggcctccattttg
cataaaggcaagctgcataccatgccgatgggctttattttaggtattccaaccaagcta
actcccttcattcggacagggctaatttctccattgggaaaagcgcgcgcagccatggat
ttgatcattccagccaagaaaggcgatatggatgaatctctgggagattttatcaagcgg
cgtctaggtaaagaggtgttggagcagattacagagcctttgttatctggtatttacgct
ggcgatacgtattctcttagcctcaagtcaaccttccctcaatttaagcagatggaacaa
aagcatggaagtctgattataggtatggctaaaggggcggggagaaagtcgggtgcacct
aacaaattgccggaaatcgccaagaaaagcatgtttctttcctatcgacatggattatcg
accatcgtggagcggttaaaggaaaagctcgacactgtccaatttgtgatggagcagcgt
gtggctgagataagaaaagagaacggttatcaggtagtcctgaaccaaggacaaatcata
gatgcagatgcaataatctgcgctattccagcctttgaggcggctaaattattttccgat
atcacaagtgtgagctggcttaataagatcaattacgtttcggtagcgaatatttccttg
gcgtataaaaattcagaccttcgcctggcctatgagggaactggatttctcgttccccgt
aaggaagggaagatgattacggcctgtacttggtcatctacaaagtggagccataccgca
cctgaagggtatacactcttgcggacttacattggccatgcaggtgcacaggaatgggtt
cagatgacagacgaggaactagtggaagcagcccgcaaagacctgaaagatctaatgggg
atcgatgctcaacctaaaatgaccgaggtcagtcggtgtaatcaatccatgccacaatat
ccgattgggcaccaagaacagatggcgaaggtgagacatgatttgtcacagtattttccg
aatgtgtttctttgtggcgctggttatggaggcgttggcattccagattgtatcgctcaa
ggcaaagaagcagctgaacagctggtctcaggtttcttataa

DBGET integrated database retrieval system