KEGG   Paenibacillus polymyxa SC2: PPSC2_c3897Help
Entry
PPSC2_c3897       CDS       T01335                                 

Definition
threonine synthase
Orthology
K01733  
threonine synthase [EC:4.2.3.1]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Glycine, serine and threonine metabolism
Vitamin B6 metabolism
Metabolic pathways
Biosynthesis of secondary metabolites
Microbial metabolism in diverse environments
Biosynthesis of amino acids
Module
Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Overview
   01230 Biosynthesis of amino acids
    PPSC2_c3897
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    PPSC2_c3897
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    PPSC2_c3897
Enzymes [BR:ppm01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     PPSC2_c3897
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4089713..4091104)
Genome map
AA seq 463 aa AA seqDB search
MRYISTRGRVEAKGFIDTVLMGLADDGGLMVPEQIPTVSGATLEQWATLSYRELLLEVFA
LYINDEIPREDLEQLVERSYASFRHPEVTPVKKINDSLSILELFHGPTFAFKDVALQFMG
EFYSYVSKKQNEIIHILGATSGDTGAAAIQGVRGKEGIKICILHPHQKVSKVQELQMTTV
DDENVLNLSVKGNFDDCQKVIKDLFADLDFKAKHHLRAINSINFVRILAQTVYYFYAYFR
AQESSGAKKINVSVPSGNFGNIFSGFLAKKMGLPIHKLIIATNENNILERFVKTGEYKPG
DFKSTYSPSMDIQVASNFERYLYYFLGEDAAKVSEYMNKLKTEGRIVIGAEDLKRVQQDF
EALGASNEQCLELIKKYKAEYDYLLDPHTACGIAAYEAYNGAGEVCVTFATAHPAKFDEA
IRLVDIKQEFPAQIEQLFAKPQHQQVVEHDEAEIVRQLEAFYA
NT seq 1392 nt NT seq  +upstreamnt  +downstreamnt
atgagatatataagcactagaggtcgagtagaagccaagggatttattgataccgtgctc
atggggttagctgacgatggaggtctgatggtaccggagcagattccgaccgtgtcggga
gctacgctggagcaatgggctacattgagctacagagagctgctgctggaagtttttgcg
ctgtatatcaatgatgagattcctcgtgaagatttggaacaactggtggagcgcagctat
gcgagcttccgtcatccggaagttacgccagtgaagaagatcaacgattccctgtctatt
ttggagctgttccatggacctacgttcgcgttcaaggatgtggcgctgcaatttatgggt
gaattttattcctacgtgtccaaaaagcagaatgaaatcattcacattttgggtgcaacc
tcaggcgataccggggcggcagccattcagggcgtacgaggtaaggaaggcatcaaaatc
tgtattttgcacccacaccaaaaggtgagcaaggtacaagaactgcaaatgacgacggta
gacgatgagaacgtgctgaatctatctgtaaaagggaactttgacgattgtcaaaaagtg
attaaggacctgtttgccgatttggacttcaaagccaaacatcatctgcgggcgattaac
tcgattaactttgtgcgtattttggcgcagacggtatattacttctatgcttatttccgg
gcgcaggagtcatcgggtgcaaagaagatcaatgtcagcgtgccttccggcaactttggc
aatatcttttccggctttctcgcaaagaaaatgggtctgccaatccataagctgatcatt
gccacgaacgaaaataatattttggagcgcttcgtgaagacaggcgaatataagccagga
gacttcaaaagcacatacagtccttcgatggacattcaagtggcgagcaatttcgaaaga
tacctgtactacttcctcggagaggatgcagccaaggtatctgaatacatgaataagctc
aaaaccgagggacggattgtgatcggggcagaggatttgaaacgggtacagcaggatttt
gaagcgcttggtgcttcgaatgagcagtgtctggagctgatcaaaaaatacaaggctgaa
tacgattatttgctcgatccgcatacagcttgcggtattgccgcgtatgaggcgtataat
ggcgcaggcgaagtctgtgtgacctttgcaacagcacatccggccaaattcgatgaggcg
atccgtctggtggatattaagcaggagttcccggcgcaaattgaacaattgttcgccaag
ccacaacaccagcaggtggtagagcatgacgaggccgaaattgtgcgtcagcttgaagcc
ttttatgcgtaa

DBGET integrated database retrieval system