KEGG   Paenibacillus polymyxa SC2: PPSC2_c3966Help
Entry
PPSC2_c3966       CDS       T01335                                 

Definition
endo-beta-1,4-glucanase
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PPSC2_c3966
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PPSC2_c3966
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
4150808..4152001
Genome map
AA seq 397 aa AA seqDB search
MKKKGLKKTFFVIASLVMGFTLYGYTPPSADAASVKGYYHTQGNKIVDESGKEAAFNGLN
WFGLETPNYTLHGLWSRSMDDMLDQVKKEGYNLIRLPYSNQLLDSSSRPDSIDYYKNPDL
VGLTPIQIMDKLIEKAGQRGIQIILDRHRPGSGGQSELWYTSQYPESRWISDWKMLAERY
KNNPTVIGADLHNEPHGQASWGTGDVSTDWRLAAQRAGNAILSVNPNWLILVEGVDHNVQ
GNNSQYWWGGNLTGVANYPVVLDVPNRVVYSPHDYGPGVSSQPWFNDSTFPSNLPAIWDQ
TWGYISKQNIAPVLVGEFGGRNVDSSSAEGKWQNALVDYIGANNLYFTYWSLNPNSGDTG
GLLLDDWVTWNRPKQDMLSRIMKPVNFIAEQVKASAE
NT seq 1194 nt NT seq  +upstreamnt  +downstreamnt
atgaagaaaaaagggttgaaaaaaacatttttcgtcattgcctccctcgtcatgggcttc
acactgtatgggtacactccaccttcggcagatgcagccagcgtgaaaggatattatcat
acccaaggaaacaagattgtagatgaatccgggaaagaggccgcatttaacggtctgaac
tggtttggtctagaaacccctaattacactttgcatggactgtggagccgctcaatggac
gacatgctggatcaggtgaagaaggaaggttataatctcatccgtctgccttacagcaat
cagttattggattccagctctcgtccggacagtattgattactacaaaaatcctgatctg
gtcggattgactccgattcaaattatggacaagctgatcgaaaaagctggacaacgcggt
attcagattatccttgaccgtcaccgcccaggctcaggtggacaatccgagctatggtat
acctctcagtaccctgagtcccgctggatcagcgactggaagatgttagctgaacgttat
aaaaacaatcctaccgtcattggtgcagatttacacaacgaaccgcacggtcaggcaagc
tggggaacaggcgatgtttccacagactggcgtctcgcggcgcagcgtgcagggaatgcc
attctgtctgtgaatccgaattggctgattctggtagaaggtgtggaccataatgtacaa
ggcaacaacagccaatattggtggggcggcaacctgacaggtgtagccaactatcctgtc
gttctggacgtaccgaaccgtgtcgtctattcaccacatgactacggtcctggtgtgtct
tcgcagccatggttcaacgattcaaccttcccgtccaacctgccagcaatctgggatcaa
acctggggctacatcagtaagcaaaacatagctccggtgctggtcggtgaattcggcggt
cgcaatgttgattcgtcttccgctgagggtaaatggcaaaatgcactcgtagactatatt
ggtgccaataacctgtactttacgtattggtccctgaatccgaatagcggcgatacaggt
ggtctgctgctggatgactgggttacctggaaccgtccgaagcaggacatgctgagccgg
attatgaagcctgtaaatttcatagcagagcaagtgaaagcaagcgccgaatag

DBGET integrated database retrieval system