KEGG   Paenibacillus polymyxa SC2: PPSC2_c4008Help
Entry
PPSC2_c4008       CDS       T01335                                 

Definition
endoglucanase celv3
Orthology
K01179  
endoglucanase [EC:3.2.1.4]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Starch and sucrose metabolism
Metabolic pathways
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Metabolism
  Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    PPSC2_c4008
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.4  cellulase
     PPSC2_c4008
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4197351..4198955)
Genome map
AA seq 534 aa AA seqDB search
MMNGQWVLPRIVKRVAVMLTAVLLLTLTNGFNWNAPTAEAAGTTPVERYGQLSVKNGKLV
DKNGQPVQLKGISSHGVQWFGDLVNQDTMKWLRDDWGISVFRVALYTEENGYIANPSLKN
KVKEAIEAAQKLGLYVIIDWHILSDGDPNTHKNEAKAFFNEFSTKYGHLPNVIYELANEP
NGNVNWNNQIRPYASEVSQVIRAKDPDNIIIVGTGTWSQDVHDAADHPLLDKNTMYTVHF
YAGTHGQSLRDRIDYALNKGVGIFATEWGTSDASGNGGPFLNESKVWTDFMASRKISWAN
WSLSDKNETSAALLPGADRKGGWPDSQLTASGKFVKQAILEGSSNHGGGSNGGNSGGDGN
NGSNNNGGNNGGDHSGSTPGGNNEGIVLQYRTDDTNAKDNAIRPQFNIKNTGKTAVKLSD
LKIRYYYTDESKQAQQFFVDWAKIGNEKVKATFVTLPNPKSKADKYVEISFTDGAGTIQP
GGETGEIQSRIHAANWSNFDETNDYSYGAAQTVFADWDHGTVYQQGKLVWGIEP
NT seq 1605 nt NT seq  +upstreamnt  +downstreamnt
atgatgaacgggcaatgggtcctgccaaggatcgtaaaaagagtagcagtaatgttaaca
gcagtgttgctattgacgttaacgaatgggttcaactggaatgcgccgacagcagaggcg
gccgggacgacccctgtggaacgttacggacaactttcagtaaagaacggtaaactggtg
gataaaaatggacaacctgtacagctcaagggcattagttctcatggcgttcagtggttt
ggggatctggtgaatcaggacactatgaaatggttacgggacgattggggcatttccgtg
tttcgagttgcgttgtacactgaagaaaatggttatattgccaacccttcattgaaaaat
aaagtgaaggaagcaattgaggcagcacagaaactgggcctgtacgtcattattgactgg
cacattctctcagatggcgatccgaacactcataaaaatgaagccaaagctttctttaat
gaattttccacgaagtacggtcatttgcctaacgtaatctatgaacttgctaatgagccg
aatgggaatgtaaactggaacaatcaaatccgaccttatgcatctgaggtatctcaggtt
attcgagctaaagacccggataatattattattgtaggaacaggtacttggagtcaggat
gtacatgatgcagcagaccatccgcttctagataaaaatacaatgtataccgtgcatttc
tatgcgggtacgcatggacaatctttacgtgatcggattgattatgccctgaacaaaggt
gtaggcatttttgctaccgagtggggtacaagtgacgcttcgggtaacggtggtccgttc
ctgaatgaatccaaagtatggactgattttatggccagtcgcaaaatcagttgggccaat
tggtcgctttccgacaaaaatgagacctctgctgccctgttgcctggtgctgaccgcaag
ggtggatggcctgattcacaattaacggcttccggcaaatttgtaaaacaggcgattctg
gaaggctccagcaatcatggtggaggaagcaacggcgggaatagcggcggagatggcaac
aatggtagtaataacaatggtggaaacaacggtggcgatcacagtggaagtacaccaggc
ggtaataatgaagggattgtgcttcaatatcgcactgatgacacgaacgccaaggataat
gcaatccggcctcaatttaatatcaaaaataccggaaaaacagctgtgaagttgagtgac
ctgaaaattcgctactattacacagatgagagcaaacaagctcagcagttttttgtagat
tgggccaagattggtaatgaaaaggtaaaagcaacttttgtaactttgccaaatccgaag
tccaaggctgataaatatgtggagatttccttcacagatggagcgggaacgattcagccc
ggcggcgaaaccggagaaattcaatctcgtattcacgcagcgaattggagcaattttgat
gagactaacgattactcctatggagctgcccaaacagtattcgcagactgggaccatggc
accgtatatcaacagggtaagctggtatggggcatagagccctag

DBGET integrated database retrieval system