KEGG   Paenibacillus polymyxa SC2: PPSC2_c4126Help
Entry
PPSC2_c4126       CDS       T01335                                 

Definition
holliday junction ATP-dependent DNA helicase ruva
Orthology
K03550  
holliday junction DNA helicase RuvA [EC:3.6.4.12]
Organism
ppm  Paenibacillus polymyxa SC2
Pathway
Homologous recombination
Brite
KEGG Orthology (KO) [BR:ppm00001]
 Genetic Information Processing
  Replication and repair
   03440 Homologous recombination
    PPSC2_c4126
Enzymes [BR:ppm01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.4  Acting on acid anhydrides to facilitate cellular and subcellular movement
    3.6.4.12  DNA helicase
     PPSC2_c4126
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif Motif
Other DBs
NCBI-GI: 
NCBI-GeneID: 
UniProt: 
Position
complement(4333804..4334418)
Genome map
AA seq 204 aa AA seqDB search
MIDFLRGSVAHLENEYVVLDVQGVGYRVFCPNPYAFAKTEGPVVIYTHHHVREDAILLFG
FATREEQQLFRKLIDVSGIGPRVALGILGGGTPAHVVTAIYQENITFLTKLPGIGKKTAQ
RMILDLKDKLDGIGALGMATGLFAEPAVEEGQGSYWSEAREALKALGYTDAELDKVWSKM
KKDAKPDDSADILMKRALQLLFAG
NT seq 615 nt NT seq  +upstreamnt  +downstreamnt
atgatagatttcttgcgtggttctgtagctcacttggaaaatgaatatgtcgttttggat
gtgcagggtgtagggtatcgggtattttgtccgaatccttacgccttcgccaaaacggaa
ggaccggtggttatttacactcaccatcatgtaagggaagatgctattttactgtttggg
tttgcaacccgtgaggagcagcaattattccgtaaattgatcgatgtgtctggtattgga
ccacgggtggctcttggtattttgggaggcggtacgcctgcgcatgtggtgacggcgatt
tatcaggagaatatcacatttctcaccaaattaccggggatcggtaaaaagacggcacaa
cgtatgattctagatttaaaagacaagctggacggtattggggcgttaggaatggctacc
ggattgtttgcggagcctgctgtagaagaaggccaaggttcgtactggagtgaggcgcgt
gaagcgcttaaagcactcggttacacggatgctgagttagataaggtatggagcaaaatg
aagaaagatgcgaaacctgatgattctgccgacattttgatgaaacgggctttgcaactg
ttgtttgccggatag

DBGET integrated database retrieval system